(data stored in ACNUC7421 zone)

EMBL: AM286690.PE369

AM286690.PE369       Location/Qualifiers
FT   CDS_pept        411865..412602
FT                   /transl_table=11
FT                   /locus_tag="ABO_0369"
FT                   /product="transcriptional activator, putative"
FT                   /EC_number="6.3.4.15"
FT                   /note="transcriptional activator putative identified by
FT                   match to PFAM protein family HMMPF03309"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15817"
FT                   /db_xref="GOA:Q0VSN1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSN1"
FT                   /inference="protein motif:HMMPFAM:HMMPF03309"
FT                   /protein_id="CAL15817.1"
FT                   /translation="MMLFVDVGNTAMKWRYRDGDVIHQGGGRHEREWSRVVELMLRSLV
FT                   GMPSEIWVASVAGPEADETIAYYLKEAIRCEPHFYYSCQSDFGVESCYPEPRKLGVDRW
FT                   VAMIEGFQRYGASIIIDCGSALTIDAVDSRGTFLGGYIVPGLGMLRGALLRDTSDVHIE
FT                   PGMAQLGLGRSTGECVHNGLLRMSVAFVTEVVLELRQVLDDTCKVLVTGGDAPELIGAF
FT                   TFEFLHAPDLVLDGLERVAARQQ"
     atgatgctgt ttgttgatgt ggggaatacc gccatgaagt ggcgctaccg cgatggtgat        60
     gtcatacacc aaggcggagg gcgccatgag cgtgagtggt cacgagtggt tgagctcatg       120
     ctgagatcat tagtaggcat gccgagtgaa atatgggtgg cctcggtggc tgggccggag       180
     gctgatgaaa caattgctta ttacctgaag gaggctattc gttgcgagcc ccatttctat       240
     tattcttgtc agtcagattt tggcgtggaa agctgttatc cagagccgag aaagctggga       300
     gtggaccgtt gggtggcaat gattgaaggc tttcagcgtt atggtgcctc catcattata       360
     gactgtggca gtgcgttaac tattgatgct gttgattcgc gcggcacttt tcttggtggc       420
     tacattgtgc ctggccttgg gatgttgcga ggcgccttgc tgagagacac atcggatgtg       480
     cacattgagc cgggaatggc gcaattggga ttggggcggt ctaccggtga gtgtgtccat       540
     aacggactct tgcgcatgtc tgtggccttt gtcacggagg tggtgcttga actgcgccaa       600
     gtgcttgatg atacttgcaa agtgctagtt accggcggag atgccccgga gctcattggt       660
     gcgtttacgt ttgagttcct gcatgcccct gatttagtcc tagatggatt ggagcgggtg       720
     gcggcacgac aacaataa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page