(data stored in ACNUC7421 zone)

EMBL: AM286690.PE370

AM286690.PE370       Location/Qualifiers
FT   CDS_pept        412620..413267
FT                   /transl_table=11
FT                   /locus_tag="ABO_0370"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15818"
FT                   /db_xref="GOA:Q0VSN0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSN0"
FT                   /protein_id="CAL15818.1"
FT                   /translation="MRWIFYSLLVINLVYVGFQLVGSLSPESASLNLSEPRHADDERLQ
FT                   LLAERPQPRSGGEAGVPSGSLCTVVGPWKNQERAEAGAVQLRAIGLAGSVRSLSVQKDR
FT                   LNWVYLPPYAGRARALQVLRELQDHGIDSFVVKNGKDANAISLGYFSSAESAEGLRVKM
FT                   RNAGYPAFVRETSRNVTEYWLYLSDSSVENNPDLKVFLEANQSLNVSKVSCL"
     gtgcggtgga tattctatag tttgttagtg atcaacttgg tctacgtagg ctttcagttg        60
     gtcggatcgc tatcccccga atcagcgtct ctgaatcttt ctgagccaag gcatgcggat       120
     gatgagcggc tgcaattgct tgcagagcgg ccgcagccac gcagtggagg cgaggccggt       180
     gtgcctagtg ggagtttgtg tacggtagta gggccttgga aaaatcaaga aagagctgag       240
     gcgggcgccg ttcagcttag agccattggc ttggcgggca gcgtgcgaag tttgagtgtg       300
     caaaaggata ggcttaattg ggtctatttg cccccttatg cgggcagagc gcgggctctg       360
     caagtattgc gtgagttgca ggatcatgga atcgacagct ttgtagttaa gaatggaaaa       420
     gatgccaatg ccatctctct gggctatttt tctagtgcag aatcagctga agggcttcgc       480
     gtgaagatgc ggaatgcggg ttacccggcg tttgttcgtg aaacgtcccg caatgtgacg       540
     gagtattggc tgtatttgtc tgattcatcg gttgaaaata atcctgacct aaaagtattt       600
     cttgaagcaa atcaatcact taatgtttcc aaagtgtcct gtctctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page