(data stored in ACNUC7421 zone)

EMBL: AM286690.PE40

AM286690.PE40        Location/Qualifiers
FT   CDS_pept        40889..41335
FT                   /transl_table=11
FT                   /locus_tag="ABO_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15488"
FT                   /db_xref="InterPro:IPR019884"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTM0"
FT                   /protein_id="CAL15488.1"
FT                   /translation="MSFWTVYLSGEIHTDWRERIVKGCIDKELDIEFSGPVTDHEASDK
FT                   VGVSILGAEEKRFWEDRLGAGINGIRTRKLIDEADLVVVRFGPKYKQWNAAFDAGYTAA
FT                   LGTPMIILHDEEHDHPLKEVDAAADAVARTPEQVVEMLAYILNA"
     atgagcttct ggactgttta tctttctgga gaaattcaca cggattggcg cgaacgcatc        60
     gtcaagggct gcatcgataa ggagctggat attgagttta gcggcccagt gactgaccac       120
     gaggctagcg acaaagtggg cgtgagtatt ttaggcgcag aagagaagcg tttctgggaa       180
     gatcgtttag gtgcgggcat caatggtatc cggacccgca agctgatcga tgaggctgac       240
     cttgtggtgg tgcggtttgg ccccaagtat aaacagtgga atgcggcatt tgatgctggt       300
     tacaccgcgg ccttggggac accgatgatc attttgcacg atgaagagca tgatcacccc       360
     ttgaaagagg tggatgctgc cgccgacgcg gtggcgcgca ctccagagca ggtggtggaa       420
     atgctggcat atattcttaa cgcttaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page