(data stored in ACNUC7421 zone)

EMBL: AM286690.PE42

AM286690.PE42        Location/Qualifiers
FT   CDS_pept        complement(42108..43025)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0042"
FT                   /product="phosphotransferase family protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15490"
FT                   /db_xref="GOA:Q0VTL8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL8"
FT                   /protein_id="CAL15490.1"
FT                   /translation="MSVYTPLSPTQLAKVLEQFGFQLRDYHAASHGIENSTFLIDGLGK
FT                   HDQPCPLVLTVFESLDHPALTPYLTLLKQLAKQHLPVPAPLATASGNDQITVAGKPAVL
FT                   MPRLPGRHDFSVDADRCRQVGALLARLHASHTEQLQPLPSERARLRDFTHHLDKLPTAD
FT                   RDNAARLLHRWLAHPAGTTLIHGDLFRDNLLWDNGEISALLDFYNACQDHPEYDLAVAL
FT                   NDWCVDARGHVVAEREHALLSAYRGQGRSVDTRRLNEALPVAALRFWLSRLAGPVSDHS
FT                   EGQGSKNPEEFARIYRQRLEAFAV"
     atgtccgtgt atacaccact cagcccgacc caactggcaa aagtgctgga acaatttggt        60
     tttcagttgc gtgattatca cgccgccagt cacggcatcg agaatagcac tttccttatc       120
     gatggccttg gcaaacatga tcagccctgc ccgctagtgt taacggtgtt cgaatccctc       180
     gaccatcccg cgctaacccc gtacctgact ctactaaaac agttggccaa acaacactta       240
     cccgtgcctg caccactagc gactgccagc ggcaacgacc aaattaccgt tgcgggcaaa       300
     ccggcagtgt taatgccgcg cctgccaggc aggcacgatt tctctgtgga tgccgatcgc       360
     tgcaggcagg ttggtgcttt gctggcacgg ctacacgcta gccacacgga gcagctgcag       420
     ccgctcccca gcgaacgggc gcggctgcgc gatttcactc atcatctaga caaattaccc       480
     accgctgatc gagacaacgc ggcacgcttg cttcaccgct ggctggccca ccccgctggc       540
     accaccttga ttcacggcga cctgttccgt gacaacctgc tatgggacaa cggtgaaata       600
     agcgctttgc tggatttcta taacgcctgc caggaccatc cggagtacga cctagccgtt       660
     gcactcaacg attggtgtgt agatgctaga ggccacgtgg tggcagaacg ggagcacgcc       720
     ttactgtcag cttatcgggg ccagggccgc agcgtagaca cccgccgctt gaatgaagca       780
     ctgccggtag cggctctgag gttctggtta tcacggctag ccggcccagt gtctgaccat       840
     agtgaagggc aaggcagcaa aaacccggaa gagtttgcac ggatttaccg acagcggctg       900
     gaagcgttcg ccgtatag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page