(data stored in ACNUC7421 zone)

EMBL: AM286690.PE428

AM286690.PE428       Location/Qualifiers
FT   CDS_pept        complement(467603..468253)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0428"
FT                   /product="DNA-binding response regulator, LuxR family"
FT                   /function="Function unclear"
FT                   /note="DNA-binding response regulator LuxR family
FT                   identified by match to PFAM protein family HMMPF00072
FT                   InterPro: Bacterial regulatory protein LuxR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15876"
FT                   /db_xref="GOA:Q0VSH2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSH2"
FT                   /inference="protein motif:HMMPFAM:HMMPF00072"
FT                   /protein_id="CAL15876.1"
FT                   /translation="MNSQEHIQQVYVVGSQQLQNALLTEFLVKKDMAAKSIPTALDITI
FT                   DALRENGQNLFLVDYHSVDVNEVIAHLLEADQEVESDVLIAVFNVDSDESLSKLAGLPM
FT                   VNGGFQHDCPQALLSKGLKAILDGELWFPRAVLQTYLMKSRTFNKTFSRSEVSLTDREV
FT                   EVLKVMATGAKNSDIACSLNLSPHTIKTHIYNIFKKINASNRLQAVNWAQENL"
     atgaatagcc aagaacatat ccaacaagtt tacgtagtag gcagccaaca actgcaaaac        60
     gccctgctta ccgaattcct cgtcaagaaa gacatggcag ccaaaagtat tcccactgcc       120
     ctggatatta ccattgatgc cctgcgcgaa aacggtcaga acctattcct ggtggactac       180
     cactccgtag acgttaacga agtcatcgcc cacctactag aagcagacca agaagtggag       240
     agcgatgtct tgatcgcggt tttcaacgtt gacagcgatg agtcactctc caagctcgcc       300
     gggcttccca tggtcaacgg cggcttccag cacgactgtc cccaggccct tctaagcaaa       360
     ggcctcaagg caattctcga tggtgaacta tggttccctc gcgccgtgct gcaaacctac       420
     ctaatgaaaa gccgcacttt caacaagacg ttttcacgca gcgaggtcag cctaaccgac       480
     cgggaagttg aggtgctgaa ggtgatggcc acaggcgcaa agaactccga catcgcctgc       540
     agcctgaacc tgagcccaca caccatcaag acccacatct acaatatttt caagaaaatc       600
     aacgcctcca acagactaca agcggtgaac tgggcccagg aaaacctata g                651
//

If you have problems or comments...

PBIL Back to PBIL home page