(data stored in ACNUC7421 zone)

EMBL: AM286690.PE431

AM286690.PE431       Location/Qualifiers
FT   CDS_pept        470522..471250
FT                   /transl_table=11
FT                   /locus_tag="ABO_0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15879"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSG9"
FT                   /protein_id="CAL15879.1"
FT                   /translation="MPRKITLALLFGVSLLLFLLLLMPAAVLVERVPALRPGGAPLVLT
FT                   NPQGVWWNGQANWQWQRRQGTVQWSLDWHGLVPGLTLKMRTTDDAARLSTWLGADWGDW
FT                   QLQHARLSLPMALVTEHIPQGSASGRVDATLMQLSFGDSRVKQLQGTLQYSGGTVSWGR
FT                   NGSALVPVLQGRLSMNNEQPTLQVEDPDNNSLLDARLANGRFELEVRRAWPMLLGVSQG
FT                   GDPDDVVFQMSQPLVLFGGQ"
     atgcctcgaa aaataacact agcgctgctt tttggcgtta gtctgctgct gtttttactg        60
     ctactaatgc ctgcggctgt gttggtagag cgtgttccgg cgctgcggcc gggtggtgca       120
     ccgttggttc tgaccaaccc ccagggggtt tggtggaacg ggcaagccaa ttggcaatgg       180
     caacgccgcc agggcactgt gcaatggtcg ctagactggc acggattagt gccagggttg       240
     acattgaaaa tgcgtaccac cgatgatgca gcgcgcctgt cgacttggtt gggcgcggac       300
     tggggggatt ggcaactgca gcatgcgcgg ctttccttgc ctatggcact ggtgacagag       360
     cacattcccc agggtagtgc gagtgggcgc gtggacgcga cgttgatgca gctttccttt       420
     ggcgatagta gggtcaagca gttgcaaggc acgctccaat acagtggcgg caccgtgagt       480
     tgggggcgta atggctcggc gttggtgccg gtattgcagg gtcgtttaag catgaataat       540
     gaacaaccca cactgcaggt ggaggacccg gataataatt cgctattgga tgctaggtta       600
     gctaatgggc gttttgagct agaggttcgg cgagcttggc ctatgctatt gggcgtgagt       660
     cagggcggcg acccggacga tgtggtattc cagatgtcgc aacctcttgt cttgttcggt       720
     ggtcagtaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page