(data stored in ACNUC7421 zone)

EMBL: AM286690.PE433

AM286690.PE433       Location/Qualifiers
FT   CDS_pept        472196..474328
FT                   /transl_table=11
FT                   /locus_tag="ABO_0433"
FT                   /product="general (type II) secretion pathway protein D"
FT                   /function="involved in a general secretion pathway (gsp)
FT                   for the export of proteins"
FT                   /note="(xcpQ) (type II secretion pathway protein XcpQ)
FT                   identified by sequence similarity; putative InterPro:
FT                   General (type II) secretion pathway (GSP) D protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15881"
FT                   /db_xref="GOA:Q0VSG7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSG7"
FT                   /protein_id="CAL15881.1"
FT                   /translation="MSGFMTPFFRTSLSKIMLLLALSAVMVTSLHAQTTNQVQASDDGE
FT                   SWTVNIRNADIQAFISQVAQMTGKNFVVDPRVRARDVTVVSTKSLTSNEVYELFLSVLQ
FT                   VHGYAAVSVGDITKIVPNTTAKQSNLPLVEKGSSSGEELVTRVIAVESTPVEELVPVLR
FT                   PLVPQYGHLAAVGSANALIISDHLDNIRRMEAIISSLDSAESEDVQVLKLKHAFAGDMV
FT                   KMLESLTPQTGGRGGKSAEGGVIVVADERTNRLIIKGDRVTRQRMLQMVRSLDTEETNN
FT                   SGAKVIRLSHGDAKSMAELLKNFVDGASVNRAGGDGKTTSVALNNNEVSIQADESLNAL
FT                   VVRAKPAMMKQIQSVISKLDVRRAQILIEAAIVEISGEQGKNLGFQYVGGSNEDGVGAV
FT                   NFGGNGLSVNSVVQALASDDPSGLSLGDGITAGLGETDSDGDLKWGALIQALSTSSDVN
FT                   LLSTPSILTLDNEEASIIVGENVPFVTGQSTNTGSGVSNPFTTIQREDVGLTLKVTPHV
FT                   AGLSTIRLELEQESSAVKDSAGDAVDIVTTTRKLQSTVLADDAETIALGGLIKDDIRVT
FT                   VRKVPFLGDIPVLGFLFRSTSKDRVKSNLMVFLKPTILGNNDRLVEMSRDKYMGLTALQ
FT                   FRLNDDGELEQVEKNPIPQSLDHIFEGRTPVPQDFRDAYFNQQNRPVPATKKDIEDKRP
FT                   KTVPGVDRQAEGDSDL"
     atgagtggtt ttatgacgcc ttttttcaga acgtctttat caaaaataat gctgctgcta        60
     gcgctgtccg ctgtcatggt gacctcgctt cacgcgcaga caacgaacca agtacaggcc       120
     agcgatgacg gtgagagctg gacggtaaat attcgcaatg cggacattca ggcgtttatc       180
     agccaggtgg cccagatgac cggcaagaac tttgtggtgg atccgcgggt tcgtgcgcgg       240
     gatgtcacag tggtatctac taaatccctg acctctaatg aggtgtatga attatttttg       300
     tccgtattgc aggtccatgg ttatgcggcc gtgtcggtcg gtgacattac caagattgtg       360
     cctaatacca cagctaaaca aagtaatctt ccgttagtcg agaaggggag ctcttccggt       420
     gaggagctcg tcacccgggt cattgcggtt gagagcacgc cggtggaaga attggttcct       480
     gtgctgcgcc cattggtccc tcaatatggc catttggctg ctgtcgggtc cgccaatgca       540
     ctgattatca gcgaccatct ggataacatt cgtcgtatgg aggcgattat ctccagcctt       600
     gatagcgcgg aatcggaaga tgttcaggtg ctgaagttga aacatgcatt tgccggtgac       660
     atggtgaaaa tgctggaaag cctgacacca cagaccggtg ggcgcggggg taaatccgct       720
     gaaggtggtg ttatcgtcgt ggcagatgag cggaccaatc gactgatcat taaaggtgac       780
     cgtgttaccc gccagcgaat gctacagatg gttcgcagcc tagacaccga ggaaacgaac       840
     aatagtggtg cgaaggttat tcgcctaagc catggtgatg ccaagagcat ggccgagttg       900
     ttgaagaact ttgttgatgg tgcctcggtg aacagggctg ggggcgatgg caagacgacc       960
     tccgttgcgt tgaataacaa cgaggtgtcg attcaggcgg atgaatcgtt gaatgcgctg      1020
     gtagttcgtg ccaaaccagc aatgatgaaa caaatacaat cggtaatcag caagctggat      1080
     gtgcgccggg cacaaatcct gattgaggcg gccattgtgg aaatttctgg ggagcaaggg      1140
     aaaaacctgg gcttccagta tgtaggcggt agcaatgaag atggcgttgg cgccgttaac      1200
     ttcggtggta atggattaag cgtcaactct gtcgtccagg cgctggcctc ggatgatccg      1260
     tctggactga gcctaggcga tgggattact gctgggttag gggaaaccga ttccgacggg      1320
     gacttgaaat ggggggcatt gattcaagct ctatccacct catcagatgt gaatctcctt      1380
     tccaccccga gcattctaac cctggataat gaagaagcgt ccatcatcgt tggcgagaat      1440
     gtcccgtttg tgaccgggca gagcaccaat accggttcgg gggtgtccaa cccatttacc      1500
     acgattcaac gtgaggacgt gggcctgacg ttaaaagtta ctcctcacgt ggccggactc      1560
     tctaccattc gcttggagtt ggagcaggaa agctctgcag tgaaggactc ggcgggtgat      1620
     gccgttgata tcgtgacgac cactcgtaag ctgcaaagca ccgtattggc tgatgatgca      1680
     gaaaccatcg ctctgggtgg gctgatcaaa gatgatatcc gggtgacggt tcgaaaagtg      1740
     ccgtttctag gcgatattcc ggtattgggc tttttatttc gctcaaccag caaggacagg      1800
     gtgaagagta atctgatggt tttcctaaag ccgacgattc taggcaataa tgatcgattg      1860
     gtagaaatga gccgtgataa atacatgggg ctgacggccc ttcaattccg gcttaatgat      1920
     gacggagagt tggagcaggt tgagaaaaac cctattccgc agagtttgga tcatatcttt      1980
     gaggggcgga ctccggtgcc acaggatttc cgtgatgcct acttcaacca gcagaataga      2040
     ccggtaccgg ccaccaaaaa agacattgaa gataagcgac cgaaaacggt acccggagtt      2100
     gatcgccaag cagaaggaga ttctgatctg tag                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page