(data stored in ACNUC7421 zone)

EMBL: AM286690.PE439

AM286690.PE439       Location/Qualifiers
FT   CDS_pept        479728..480090
FT                   /transl_table=11
FT                   /locus_tag="ABO_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15887"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSG1"
FT                   /protein_id="CAL15887.1"
FT                   /translation="MIIVKGSFPIKEDEQPDALALVQALASASRGERGCLAYEVYLQAD
FT                   APRVIMVWQQWSNLDALEIHFGSEHVGAFLDAIPDMIDGDVTSARFDVSSMDGDPIVEE
FT                   VGEIVPMVLADNIILH"
     atgattatag tgaaaggctc ctttcccata aaagaagacg aacagcccga tgcgttggcg        60
     ctggtgcaag cgcttgctag tgcgtcgcgg ggggagcggg gatgtttggc ctatgaagtg       120
     tatctgcagg ccgatgcgcc acgagtaatt atggtgtggc agcagtggtc gaaccttgat       180
     gcgctggaaa tccactttgg ctccgagcat gtgggcgcct tcctggatgc cattcccgac       240
     atgattgatg gtgatgtcac ttctgctcgg tttgatgtgt ccagcatgga tggcgacccc       300
     attgtagaag aggtgggcga gattgtgccc atggtgctgg cggacaatat tattttgcac       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page