(data stored in ACNUC7421 zone)

EMBL: AM286690.PE44

AM286690.PE44        Location/Qualifiers
FT   CDS_pept        complement(44641..45114)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0044"
FT                   /product="AhpC/TSA family protein"
FT                   /function="directly reducing organic hyperoxides in its
FT                   reduced dithiol form"
FT                   /EC_number="1.11.1.-"
FT                   /note="AhpC/TSA family protein identified by
FT                   sequencesimilarity; putative"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15492"
FT                   /db_xref="GOA:Q0VTL6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL6"
FT                   /protein_id="CAL15492.1"
FT                   /translation="MSIAVGDNLPSITLKTNGPDGPQDLNTGDFFKGRKVVLFAVPGAF
FT                   TPGCSNTHMPGFVINADALLEKVDAIACMAVNDAFVMGAWQKDQNAERITMLADGNAEL
FT                   AKALGLELDATGGCMGIRSKRFALIANDGVVEYLGVDAKGVDKSSADTVLKQL"
     atgagcattg cagttggcga caacctccct tctatcacgc tgaaaaccaa cggtcccgat        60
     ggcccccagg acctcaacac cggtgacttt ttcaaagggc gtaaagttgt cctgtttgcc       120
     gttcccggag cattcacccc tggctgttcc aacacccaca tgcccggctt cgtcattaac       180
     gccgatgcgt tgctggagaa agtcgatgcc attgcctgta tggcagtgaa cgatgccttt       240
     gtgatgggtg cttggcagaa agatcagaat gccgagcgta ttaccatgct agcggatggt       300
     aacgctgaac tggccaaggc gctggggcta gagctagacg cgaccggtgg ctgtatgggc       360
     attcgcagca aacgtttcgc gctgattgcc aacgatggcg tagtggaata tctgggcgta       420
     gatgccaaag gcgtggacaa gagcagtgcg gacaccgtac tgaaacaact atag             474
//

If you have problems or comments...

PBIL Back to PBIL home page