(data stored in ACNUC7421 zone)

EMBL: AM286690.PE445

AM286690.PE445       Location/Qualifiers
FT   CDS_pept        complement(487392..487820)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0445"
FT                   /product="hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15893"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSF5"
FT                   /protein_id="CAL15893.1"
FT                   /translation="MGELKDLREQSESLVNRAKQLGNKLYLAGLGAYEKAEEGSEELFN
FT                   KYVETGSKAFGEEAESKPKALLASRGALVAARELLDSAPEKRLALYQKLLEAGKKERGE
FT                   KAEETNEYLLASLGAVATAREEGEKLFNELVSTGEKRD"
     atgggcgagc tgaaagatct ccgcgaacaa agcgaatctc tggtaaaccg tgccaagcag        60
     ctaggtaaca agctgtactt ggcaggcttg ggcgcctacg aaaaagccga agaaggctct       120
     gaagagctat tcaacaaata cgttgaaacc ggctctaaag catttggcga agaagctgag       180
     agcaaaccca aggccctgct agcaagccgt ggcgcactgg tcgctgcccg cgagttgctc       240
     gacagcgccc cggaaaagcg cctggccttg taccaaaagt tgcttgaagc tggcaagaaa       300
     gaacgcggtg aaaaagccga agaaaccaat gaatatctgc tggcaagtct tggcgccgtt       360
     gccactgccc gcgaagaagg tgagaaactg ttcaatgagc tggtttccac tggcgaaaaa       420
     cgcgactga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page