(data stored in ACNUC7421 zone)

EMBL: AM286690.PE449

AM286690.PE449       Location/Qualifiers
FT   CDS_pept        complement(490339..490620)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15897"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSF1"
FT                   /protein_id="CAL15897.1"
FT                   /translation="MPSSRVVIHYCSQCNWLLRSGWYAQELLATFSDELDEVALRPSTG
FT                   GIFWIEANGQQIWERKKDGGFPEITELKRRVRDALFPERDLGHIDRKG"
     atgcccagca gccgcgttgt cattcactac tgcagccaat gcaactggct gctgcgtagc        60
     ggttggtatg cccaggaatt actagcaacg ttcagcgatg aactggatga agtggccttg       120
     cggcccagta ccggtggaat attctggatt gaagctaacg gtcaacaaat ttgggaacgt       180
     aaaaaagatg gcggcttccc ggagattacc gagttaaaac ggcgagtacg ggacgcccta       240
     ttcccggaaa gggatttagg gcatatcgac cgaaaggggt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page