(data stored in ACNUC7421 zone)

EMBL: AM286690.PE45

AM286690.PE45        Location/Qualifiers
FT   CDS_pept        complement(45377..47296)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0045"
FT                   /product="hypothetical secreted protein"
FT                   /note="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL5"
FT                   /protein_id="CAL15493.1"
FT                   /translation="MLHLTRLLLLFTFMAVLTACGDGGGSSSSGSTSTNQETGNTGSGD
FT                   TGGGDTDGSDTDSGDTDGGDTGGGDEDDTVPPVTEEEEAQLLTLIDTNNHFTVSVCPQA
FT                   LLGTQLGGAIDVLTCENEALENISLGNDNLLGLLCADTVAATESNLLSSATNPDFLQNC
FT                   LLESGAYLKDTLTGLLDNSGPIGQQLCPSSTNPIECIIETVNTVPDSTLIGVLGYLGCE
FT                   DSLNPQVCLSQVAENLSKGEPLISTVNSLSTALCPISTRADNFQPQACLTEVLGGVGSI
FT                   LNLSGGLGELCPEDADPLTCLLAAGEKLGPVGDLLGGGTINPGILTDLLAGLAEPGNLA
FT                   LLETLPTLLEQIPVLGDLLAGLLNNGGDLFAPLKDLQTLPELLTQLPILGDLLNGIAGG
FT                   DSGGLPTDALDLESLLNGLSGDQLTVVTDLLAEIPVLGNVIDQLLGAVACESGSPLDCL
FT                   TQSAGQLGQFGDLLTEVPLLGDLLEPLLATLTGVASGGELLAGVDLLNEVPVVGDLLNQ
FT                   ILTVLQGGAGDSLLTPDLAMLIEQPALQGLLDSLLGGLVGGLAGGDPSQLLNGILDQDG
FT                   NLLDAVIGLVQSLPIVGDLVGSLLVSLLGENAAGSLLAPLSDVLADIPVLGPVLGGLLG
FT                   GLLG"
     atgttacatt tgacccgatt attgctgcta tttaccttta tggcagtatt aaccgcctgt        60
     ggcgacggcg gcggcagcag ttcttccggt agcacaagta ccaaccaaga aaccggtaac       120
     accggcagcg gcgacactgg cggcggcgat accgacggca gcgataccga cagcggagac       180
     accgacggcg gcgatactgg cggcggcgat gaagacgaca ccgtgcctcc ggtaacagag       240
     gaagaagaag cccagctcct cactttgata gataccaaca accatttcac cgtatcagtt       300
     tgcccgcagg ctctgcttgg cactcaattg ggcggcgcta ttgatgtgct gacctgtgaa       360
     aatgaggcac tggaaaatat ctctcttggc aatgacaacc tactcggcct gctatgtgcc       420
     gacaccgttg ctgccaccga atctaactta ctcagcagcg ccaccaaccc agatttccta       480
     cagaattgtc ttttggagtc gggtgcttac ctgaaagaca ctctgacagg attgttggat       540
     aacagtggcc ctatcggcca acaactgtgc cccagctcca ctaacccaat cgagtgcatc       600
     attgaaactg tcaacaccgt gccggacagc acgcttatcg gtgttctcgg ttatttgggc       660
     tgcgaggatt cactgaaccc gcaagtgtgc ttaagccaag tggctgaaaa tctgtccaag       720
     ggcgagccac taatcagcac agtgaatagc ttgtccaccg ccctgtgtcc aatatctacc       780
     cgcgccgata attttcagcc ccaagcatgt ttgaccgaag tgctcggcgg cgttggcagc       840
     attcttaacc tgtccggtgg tcttggcgaa ttgtgccctg aagatgcgga tccactaacc       900
     tgtctgctgg ccgccggtga aaagctaggc cctgtgggcg acctgctggg cggcggaacc       960
     atcaacccag gaatcttaac ggacctgctg gctggccttg ctgagccagg caacctcgcg      1020
     ttgctggaaa ccctccccac tctgctggag caaattccgg ttctgggcga tctgcttgct      1080
     gggctactga acaacggcgg cgatcttttt gcgccactga aagacctgca aacccttccc      1140
     gaattgctca cccagctccc tatccttggg gatctactca acgggattgc tggcggcgat      1200
     agcggtggcc taccgacaga cgccttagat ttggaaagcc tgctgaacgg cctgtctggc      1260
     gaccaactaa ctgttgtcac cgacctgctg gctgaaatcc ccgtattggg taatgtgatc      1320
     gaccaactgc taggtgctgt ggcgtgtgaa tctggcagcc cattagattg cctgactcaa      1380
     tctgctggcc agttaggaca gttcggcgat ctattaaccg aagtccctct gctgggcgat      1440
     ctattggagc cactactggc caccctgacc ggagtggcaa gcggaggcga gctcttggct      1500
     ggcgtcgacc tactcaatga agtacccgtc gtaggtgatt tgcttaacca gatcctcact      1560
     gtgctgcaag gtggtgccgg agatagcctt cttactcccg atctggccat gctcattgag      1620
     caacccgccc tacaaggcct gctcgacagc ctgcttggcg gcctggtggg tggcttggca      1680
     ggtggcgatc ccagccaact gcttaacggc attctggacc aggatggcaa tttgctcgac      1740
     gcagtgatcg gcttagtaca gtcactaccg atagtaggcg acctagtagg ctcactgctg      1800
     gtaagcctgc tcggtgagaa tgctgccggc tcgctgctag ccccgcttag cgatgtgctg      1860
     gctgacattc ctgtactcgg cccggttctg ggtggattac taggcggtct gctcggctaa      1920
//

If you have problems or comments...

PBIL Back to PBIL home page