(data stored in ACNUC7421 zone)

EMBL: AM286690.PE464

AM286690.PE464       Location/Qualifiers
FT   CDS_pept        504463..504981
FT                   /transl_table=11
FT                   /locus_tag="ABO_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15912"
FT                   /db_xref="GOA:Q0VSD6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSD6"
FT                   /protein_id="CAL15912.1"
FT                   /translation="MMITGKQQRGVGLIEVMIALLVLAIGVLGYAGMQLTALKASEDAN
FT                   NRAQATLLGQDALERFLANETAMASYTDVDQWPDESTPPGEKPDVLNDCITSSCNANDL
FT                   ASWDISMLAWQAANQLPAGMIAVDECQHATGISCVVVSWNDDEPNDCMTNDGVNTGIGT
FT                   SCVVLEVAR"
     atgatgatca cgggaaaaca acaacgtggt gtggggctta tcgaggtgat gattgccttg        60
     ttagtgctag caattggagt gcttggctat gcgggaatgc agcttaccgc gctgaaagcc       120
     tcggaggatg ctaacaaccg agcacaagcc actttactcg gacaggatgc tcttgagcgt       180
     tttcttgcca atgaaaccgc aatggcttct tacactgatg tagatcaatg gccagatgag       240
     agtacgcccc ctggggaaaa gccggatgtg ctgaatgatt gtattaccag ctcctgtaat       300
     gcgaatgatc ttgcctcgtg ggatatcagc atgcttgcgt ggcaggcggc gaatcagttg       360
     cctgcgggaa tgattgcggt tgacgaatgt cagcatgcta ccgggattag ttgtgtggtt       420
     gttagctgga acgatgatga gcctaatgac tgcatgacga atgatggcgt taacacaggt       480
     ataggtactt cttgcgtggt gctggaggta gcgcgatga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page