(data stored in ACNUC7421 zone)

EMBL: AM286690.PE468

AM286690.PE468       Location/Qualifiers
FT   CDS_pept        509301..509750
FT                   /transl_table=11
FT                   /locus_tag="ABO_0468"
FT                   /product="secretion protein, putative"
FT                   /function="Tfp pilus assembly protein PilE"
FT                   /note="secretion protein putative identifiedby sequence
FT                   similarity; putative InterPro: Fimbrial protein pilin"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15916"
FT                   /db_xref="GOA:Q0VSD2"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSD2"
FT                   /protein_id="CAL15916.1"
FT                   /translation="MMSGKSVCKGRDQQGFTLIELMIVVVIVAILASIAYPSYTRYVQD
FT                   TRQAEAQGEMMALAGALERYRAKNFSYKGANTKLAVLSPVLANSDYFTTAISVTGTGSQ
FT                   QYEITVTPKTGVMTGTEVLKINSEGQTCMKVSGCTIGTDDSWKEH"
     atgatgtctg gaaaatcggt gtgtaaaggc cgtgatcagc aaggctttac cctgattgag        60
     ctgatgattg tggtggtgat agtggcgatt ctcgcctcta ttgcttaccc cagttatacc       120
     cgttatgtgc aggatactcg ccaggcggaa gcgcagggtg agatgatggc cttggctggt       180
     gcacttgagc ggtaccgagc aaagaacttt tcctacaaag gtgccaacac taagctggca       240
     gttctatcgc cagtgcttgc caatagtgac tatttcacta ctgcaatctc cgtgacggga       300
     acggggagtc agcagtatga aattacagtg acgccgaaaa cgggcgtaat gacgggcacc       360
     gaagtgttga agatcaatag tgaagggcag acatgtatga aggtttctgg ctgcactatt       420
     ggcacggacg attcttggaa agaacattaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page