(data stored in ACNUC7421 zone)

EMBL: AM286690.PE469

AM286690.PE469       Location/Qualifiers
FT   CDS_pept        complement(509747..510277)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15917"
FT                   /db_xref="GOA:Q0VSD1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSD1"
FT                   /protein_id="CAL15917.1"
FT                   /translation="MGALKMARHYQRPQQYGLTLIEILTSITIIGVLSVCASYAWNDII
FT                   PRYQVRTATMTLHSLIRQARAGAITDGNRMICDGQNGCNKFEETQQVWMGFDRNNDGNL
FT                   NASEIIEHYQLPGQTRLIWKRFKGNALVFHNKGNSHFQNGSFYLCNPVAARRITMNWIG
FT                   RPRVETAKPEDCD"
     atgggagccc taaagatggc ccgccactat caacgcccac aacaatacgg tttaacgctg        60
     attgaaatat tgacaagcat cactatcatc ggtgttcttt ctgtctgtgc ttcctatgcg       120
     tggaatgaca tcattcctcg ctatcaagtt cgcacagcca ccatgacatt gcacagcctg       180
     ataagacagg ctcgtgccgg ggcgattacc gatggtaacc gcatgatctg cgatggacaa       240
     aacggttgta ataaattcga ggaaacacaa caagtttgga tggggttcga tcgaaacaac       300
     gatggaaatc tgaacgcatc cgaaatcatt gagcactacc agctcccagg gcaaacacgc       360
     ctaatctgga aacgtttcaa aggtaatgcg ttggtctttc acaacaaggg caacagccat       420
     ttccaaaatg gcagctttta tctatgcaac cctgtcgcgg caagaagaat taccatgaac       480
     tggattggcc gccctagagt ggagacggcc aaaccggaag actgcgatta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page