(data stored in ACNUC7421 zone)

EMBL: AM286690.PE47

AM286690.PE47        Location/Qualifiers
FT   CDS_pept        complement(50181..50675)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0047"
FT                   /product="hypothetical protein predicted by
FT                   Glimmer/Critica"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15495"
FT                   /db_xref="GOA:Q0VTG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTG7"
FT                   /protein_id="CAL15495.1"
FT                   /translation="MSAPTSAVQRLNMFWFLVLSAPLLIGIAIAGLVWFGNYTASIEWL
FT                   PQDTLRTGAMGAMALMLVIARPLRNALLAPSTIAQRSVQTTTPADPAGDTAVFKVQASM
FT                   FMLLGILDAVSMIVIALSLMQADALLALLNGVYTLVLAIIARPDFAALLDATRNQLTQK
FT                   G"
     atgtccgcgc ctacttcagc cgtacagaga cttaatatgt tttggtttct ggtgctctca        60
     gcaccgcttt tgatcggcat agccattgcc ggcctagtct ggttcggtaa ctacacggcc       120
     tccatagaat ggctgccgca agacacccta cgcacggggg ccatgggcgc catggcactc       180
     atgctagtga ttgccaggcc gctgcgtaat gcactgctag ccccctccac cattgcccag       240
     cgttcggttc aaaccaccac ccccgctgac cctgccgggg acacggcggt attcaaggtt       300
     caagccagca tgtttatgct gttgggcatt ctcgatgcgg tatccatgat tgttatcgct       360
     cttagcctaa tgcaagcgga tgccctgcta gccctgctca acggtgttta tactctggtt       420
     ctggcgatta tcgcccgccc agattttgct gctctactag acgccacccg taaccaactg       480
     acacaaaagg gataa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page