(data stored in ACNUC7421 zone)

EMBL: AM286690.PE475

AM286690.PE475       Location/Qualifiers
FT   CDS_pept        complement(516462..517280)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0475"
FT                   /product="competence lipoprotein ComL, putative"
FT                   /note="identified by sequence similarity; putative shows
FT                   high similarity to the PFAM(UPF0169)protein. Members of
FT                   this family are predicted to be lipoproteins. The function
FT                   of these proteins is unknown. Possibly this protein is
FT                   involved in DNA uptake."
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15923"
FT                   /db_xref="GOA:Q0VSC5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSC5"
FT                   /protein_id="CAL15923.1"
FT                   /translation="MPRLLWPLLCLLILAGCAANPEDRPELTEADQYREARESIESKNY
FT                   LTAIDQLKELEARFPYGDYAEQSALDLIYAQYKSVDYPATVVAAQRFMRNHPAHPRMDY
FT                   ALYMRGLANFNMEKGLFDNMVASDRSSKDMAAAKDAFRDFERLVSRFPDSEYAPDARAR
FT                   MVHIRNQLARQELHVARYYARRGAIVASLNRAQYVVKHYQHTPAVEESLAIMVKGYQRL
FT                   ELPKQAEKSRAVLALNWPNSTFLDDDKHVDLAWWPDEDNGLLSLLTFDLL"
     atgccacgac ttttatggcc actattgtgt ctactgattc tggccggctg tgccgctaac        60
     cctgaagatc gcccggagct caccgaggcc gatcaatatc gggaagcccg cgagtccatt       120
     gaatcgaaaa actatctgac ggccatcgac cagctcaaag agctggaggc gcgttttccg       180
     tatggagatt atgccgaaca gtccgcactg gacctgattt acgcccagta caaatctgtg       240
     gactacccag ccacagtggt agcggcacag cgtttcatgc gcaaccatcc cgcccatccg       300
     cgcatggatt atgcgctcta catgcgcggg ctggccaact tcaatatgga gaagggcctg       360
     tttgacaata tggttgcctc cgaccgctcc agcaaggata tggctgccgc aaaagacgcc       420
     ttccgcgact tcgagcgctt ggtcagccgc tttccggaca gcgagtacgc ccctgacgct       480
     cgcgcccgca tggtacatat ccgcaatcaa ctcgcccggc aggaactcca cgtggcacgc       540
     tattacgcgc ggcgcggcgc catcgtcgcc tctcttaacc gagcgcagta tgtggtaaaa       600
     cactatcagc ataccccagc cgtggaagaa agcttggcca ttatggtgaa aggctaccaa       660
     cggctagagc tccccaagca ggctgaaaaa agccgcgcgg tgctggccct gaactggccc       720
     aacagcacct ttctagatga cgacaaacac gtagacctgg cttggtggcc agatgaggat       780
     aacggcttac tcagtttgct gacattcgat ttgttataa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page