(data stored in ACNUC7421 zone)

EMBL: AM286690.PE477

AM286690.PE477       Location/Qualifiers
FT   CDS_pept        518410..519156
FT                   /transl_table=11
FT                   /locus_tag="ABO_0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15925"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSC3"
FT                   /protein_id="CAL15925.1"
FT                   /translation="MSLPDKSEWLCPDWNPHPAVRVCVTTRAGDLSPKPWNGLNLGLNC
FT                   GDQPERVERARHHVEKQLQADHPAAWLWQVHGKRVMRADEQNNEADGVWTDQQRWPCVV
FT                   LTADCLPVLLARKDGTAVAAVHAGWRGLQAGIIAEGVARIAPSGEPVSAWLGPAICGQC
FT                   YQVGDDVYRAFTMGRPAFEPAFKKDATPNHWRFSVAHAAIIELALLGIDDVHGGDLCTA
FT                   CDLSRFYSYRKEGQTGRFASLIWLDG"
     atgtcactac cggacaagag tgagtggttg tgcccggatt ggaatccaca cccggcagtg        60
     cgggtatgtg tgaccacccg ggctggcgat ctctccccta aaccttggaa cggtttaaat       120
     ttggggctga attgtggtga ccagcctgag cgagtggagc gggcgcgcca ccatgtggag       180
     aaacaattac aggcggatca tcctgcggcc tggttgtggc aggtccatgg caaacgggtg       240
     atgcgggcag atgagcagaa taatgaggca gacggtgttt ggaccgatca gcagcgttgg       300
     ccttgtgtcg tgctgacggc tgattgtttg cccgtgttgc tcgctcgcaa ggatggcacg       360
     gcggtggcgg cggtgcatgc cggttggcgc ggcttgcaag cgggcattat cgccgaaggg       420
     gtcgctcgta ttgctcccag cggtgagcca gtgagtgctt ggctagggcc ggccatttgt       480
     gggcagtgtt atcaggtggg ggatgacgtg tatcgcgctt tcaccatggg tcgcccggct       540
     tttgagcctg ccttcaagaa agatgctacc cctaatcatt ggcggttttc tgtggcccac       600
     gctgccatta ttgagctggc cctgttgggc atcgacgatg ttcatggtgg agatctttgc       660
     acggcctgtg atttgtcccg cttttactcc tatcgtaagg aaggccaaac gggtcggttc       720
     gcctcactga tctggcttga tggatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page