(data stored in ACNUC7421 zone)

EMBL: AM286690.PE478

AM286690.PE478       Location/Qualifiers
FT   CDS_pept        519166..519387
FT                   /transl_table=11
FT                   /locus_tag="ABO_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15926"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSC2"
FT                   /protein_id="CAL15926.1"
FT                   /translation="MLSGEGEWTPLYGLFFLLSKNKEAAIQDWARPLCFKAMVMLVIAR
FT                   YQFAISKKQLTLKLAQSDPSMIQLIDNR"
     ttgttaagcg gggagggtga gtggactccg ctatatgggc tgttttttct tttatccaaa        60
     aacaaagagg ctgcgatcca ggattgggcg cggcctcttt gctttaaggc tatggtcatg       120
     cttgttattg cgcggtatca attcgctatt tccaaaaaac aattaacctt gaagctggcc       180
     caatcggacc catctatgat tcagttgata gataaccggt ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page