(data stored in ACNUC7421 zone)

EMBL: AM286690.PE48

AM286690.PE48        Location/Qualifiers
FT   CDS_pept        complement(50728..51213)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0048"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15496"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTG6"
FT                   /protein_id="CAL15496.1"
FT                   /translation="MPSFDIVSEIDEVALRHAVENANRELSTRFDFRGVEASIAQNGLA
FT                   VTLKTESDFQVRQLEELFTKACLKQNISAAGADKPEELEHSGKTFSLTLTFRQGIDQPV
FT                   AKQIVKLIKESKIKVQASIQGDQVRVNGKKRDDLQAVMALLRESKIETPLQFNNFRD"
     atgccgtctt ttgacattgt ttccgagatt gatgaagtgg cccttcgcca tgcagtggag        60
     aacgccaacc gtgaactttc cacccggttt gatttccgtg gcgtagaagc cagcatcgcg       120
     cagaacggct tggccgttac cctgaaaacc gaatccgatt tccaggtacg tcagctggaa       180
     gaattgttta ccaaagcctg cctgaagcag aacatcagcg ccgccggtgc cgacaaaccc       240
     gaagagcttg agcacagcgg caagaccttc tcgcttacac tgactttccg tcagggcatc       300
     gaccagcccg tggccaaaca aatcgtcaag ctcattaagg aaagcaagat caaggtgcag       360
     gcatctattc aaggcgacca agtacgagta aacggcaaaa aacgcgatga cttgcaggcc       420
     gtaatggccc tgctgcgaga atcgaaaatc gaaacgccgc tgcaatttaa taactttaga       480
     gattaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page