(data stored in ACNUC7421 zone)

EMBL: AM286690.PE484

AM286690.PE484       Location/Qualifiers
FT   CDS_pept        complement(527392..528279)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0484"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="transcriptional regulator LysR family identified by
FT                   match to PFAM protein family HMMPF03466 InterPro: Bacterial
FT                   regulatory protein LysR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15932"
FT                   /db_xref="GOA:Q0VSB6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSB6"
FT                   /inference="protein motif:HMMPFAM:HMMPF03466"
FT                   /protein_id="CAL15932.1"
FT                   /translation="MDTKPLRLFLTLADTLHFGRTSSMCHVSPSTLSRTIQQLEEELNV
FT                   PLFYRDNRSVTLTREGQRFQEYARDTLMRWDGLRHALQEDRRILQGELRLYCSVTASYS
FT                   FLYDLLSSFRHQYPRIELKLHTGDPAQAVQRIQQGEEDIAIGARPDHLPSGIAFRPIAR
FT                   SPLLFIAQAGQTQLAERLNGVAKQADWKDTPMILSEEGLARERVDRWFRQLGAKPHIYA
FT                   QVSGNEAIVSMVSLGFGVGVVPKIVLDNSPLAGRTRSLDVQPALAPYEVGLFTQERRQE
FT                   EPLINAFWSQLGDT"
     atggacacca aacccctgcg gctgttcctg accctagccg acaccctgca ctttgggcgc        60
     accagctcca tgtgccacgt aagcccttcc acactcagcc gtaccattca acagctggaa       120
     gaagagctga acgtgccatt gttctaccgt gacaaccgca gcgttaccct gactcgagaa       180
     ggccaacgct tccaggaata tgcccgcgac acactgatgc gctgggatgg cctgcgccat       240
     gcattacagg aggatcgccg cattctgcag ggtgagctgc gcctgtattg ctccgtgacc       300
     gccagctata gctttctcta cgatctactc agcagttttc ggcaccaata ccctcgtatc       360
     gaactaaagc tgcatactgg cgacccggct caagccgtgc agcgcatcca gcagggcgaa       420
     gaggatatcg cgatcggcgc acgacctgat cacctcccca gcggcatcgc ctttaggccc       480
     attgcccggt cccctttact gtttattgcc caggccggac aaacccagtt ggcggaacgg       540
     ctcaacggtg tagccaagca agcggactgg aaagacactc ccatgattct ctcggaggaa       600
     gggttggcac gggaacgggt agatcgctgg tttcgccagc ttggcgcgaa gccgcatatc       660
     tatgctcagg tcagcggcaa cgaagccatc gtcagtatgg tcagcctagg atttggggtg       720
     ggcgtggtgc cgaagattgt gctggataac agcccgctag ccggacgcac ccgatcattg       780
     gatgtgcagc ccgcccttgc accttacgaa gtagggctgt ttacccagga gcgacgccaa       840
     gaagaaccgc tcattaatgc gttttggtca caattaggtg atacctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page