(data stored in ACNUC7421 zone)

EMBL: AM286690.PE488

AM286690.PE488       Location/Qualifiers
FT   CDS_pept        complement(536881..537825)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0488"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="(conserved hypothetical protein TIGR00147)
FT                   identified by sequencesimilarity; InterPro: DAG-kinase
FT                   catalytic domain (presumed)"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15936"
FT                   /db_xref="GOA:Q0VSB2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR022433"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSB2"
FT                   /protein_id="CAL15936.1"
FT                   /translation="MLYSMAPVNDRVLPMSKKALLILHGKQADNQSVRNAVIDWRNQGH
FT                   ELAVRVTWEGGDAERYVREALDNGFKTIIAGGGDGSVRDITQALMENGNSELELAIIPL
FT                   GTANDFATAAEVSEEPADALSLLNRPAQPCDVIRVNNHYFLNMATGGFGTEVTTQTSEE
FT                   LKKMLGGAAYLLTGLTRFSEIESAKGHFKGEDFEWEGDFLALGLGNGRQAGGGQRLCPD
FT                   ALVNDGLFDVAILPADMDLLAGVKELFDSEARQDPDQEGLFVRTRLSEMKIETPTPMNL
FT                   NLDGEPIQNTTFQIQAIRNALRLYLPEGCPLLG"
     atgctttatt ctatggcacc agtcaacgac agagttctcc ccatgagcaa gaaagcctta        60
     cttatccttc acggcaagca ggccgacaac cagtccgttc gcaatgcggt cattgactgg       120
     cgtaaccagg gccatgagtt agccgtccgc gtaacgtggg aggggggcga cgcggaacgc       180
     tatgtccgcg aagcgctcga taacggcttc aaaacgatta ttgccggcgg cggagacggc       240
     tcggtacgtg acatcaccca agcactgatg gaaaacggta atagcgaact ggaactagcg       300
     attatcccgc tcggcacggc caacgacttt gccacggctg cagaagtttc ggaggagccc       360
     gccgacgcct tgtcattgct taataggcct gctcagccgt gtgatgtaat ccgagtaaat       420
     aaccattatt ttctcaacat ggccaccggc ggtttcggca cagaggtcac cacacaaacg       480
     tccgaagagt tgaaaaaaat gcttggcggt gcagcctact tgcttaccgg cctaactcgg       540
     ttttcggaaa ttgaatccgc caaaggtcac ttcaaaggag aggattttga atgggaaggt       600
     gattttctgg ctctcggcct aggcaatggc cggcaagccg gaggtgggca acgcctgtgt       660
     ccagacgccc tggtcaacga tgggctcttc gatgtcgcca tcctgcccgc agacatggat       720
     ctactcgctg gagtgaaaga gctgttcgac agtgaagcgc gacaagatcc cgaccaagaa       780
     gggctttttg ttcgtacccg acttagcgaa atgaaaattg aaactccaac gcccatgaac       840
     ctgaacctgg atggtgaacc aattcagaat acaacttttc agattcaagc cattcgcaat       900
     gcgctgcgcc tttacctgcc cgagggctgt ccactgttag gctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page