(data stored in ACNUC7421 zone)

EMBL: AM286690.PE49

AM286690.PE49        Location/Qualifiers
FT   CDS_pept        51434..52393
FT                   /transl_table=11
FT                   /locus_tag="ABO_0049"
FT                   /product="Hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15497"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTG5"
FT                   /protein_id="CAL15497.1"
FT                   /translation="MPLKERLSADSLMESFPGSRDLLTRLGLLGAQVSRKIAIDQVKVD
FT                   SGMLSNLKVDKVSLGSASIGTLSVTNGSASLNNASAVLNQVRSIVELGLRLDWEIDLGW
FT                   IGNWDGSESLGSLDVPVDLGTITIPDLADIDLQIPAIDIPGLVADMQPIRDLDLGSLEI
FT                   AGMRLDKLGLPSAGLSVSGMGIGELSLSSLSVPAAEGESLRVNHAAPTGQLKLPGASLS
FT                   NVNIPSISLPSAQSGAFDADATASDKSLTVDLGILKVTIAVTPTVHLNVGSMTLKDAQL
FT                   SAKLGNVSLNEISLPVALEGISGGGLGLSSINVSKLTF"
     atgccactta aggaaaggct gtccgctgac agcttgatgg aatcgttccc gggttctcgg        60
     gatctattga ctcgtctggg cctgctcgga gcccaagtat cccgcaagat cgctatcgac       120
     caggtcaagg ttgatagtgg catgctcagt aatctcaagg tcgacaaggt ttcgctgggt       180
     agcgccagca ttggcaccct aagtgtgact aacggctcgg ccagcctcaa taacgccagt       240
     gcggttctca atcaggtgcg cagcattgtg gagttgggtt tacggctgga ttgggaaatc       300
     gatctaggct ggattggtaa ctgggatggc agtgaaagtc ttggcagcct ggatgtcccg       360
     gtggatttgg gcactattac tattcccgac ctggctgata tagacctgca gattccggcc       420
     atcgacatcc caggtttggt tgccgatatg cagccgatcc gtgacttgga tttggggagc       480
     ttggaaattg ccggaatgcg gttagacaag ttggggctgc ccagtgccgg tttgtcggta       540
     tccggcatgg ggattggtga attatcgctt agctcgttaa gcgtacccgc cgctgaaggt       600
     gagtcactgc gggtcaatca cgctgcacca accggacagc ttaagctgcc tggcgctagc       660
     ctcagtaatg tgaatattcc ttctattagc ttgcccagcg cgcaaagtgg tgcctttgat       720
     gccgatgcca ctgcctccga caaatcgctg acggtggacc tagggattct aaaagtcacc       780
     attgccgtca cgccaacggt ccatctcaat gtgggtagca tgaccctcaa ggatgcccag       840
     ttgtcggcga agttgggtaa tgtttctctc aacgaaatta gcttgccggt ggcattggag       900
     ggcatctctg gtggcgggct gggcctgagc agcattaacg tcagtaagct gacattctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page