(data stored in ACNUC7421 zone)

EMBL: AM286690.PE490

AM286690.PE490       Location/Qualifiers
FT   CDS_pept        538199..538942
FT                   /transl_table=11
FT                   /locus_tag="ABO_0490"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="transcriptional regulator TetR family identified by
FT                   match to PFAM protein family HMMPF00440 InterPro: Bacterial
FT                   regulatory proteins TetR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15938"
FT                   /db_xref="GOA:Q0VSB0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSB0"
FT                   /inference="protein motif:HMMPFAM:HMMPF00440"
FT                   /protein_id="CAL15938.1"
FT                   /translation="MFTLLGPLVKLPKAIDFKGRHVQRPSSDIDAIRQVVNQVLEVHAL
FT                   EEGGQRSQARAEILIHSMQVFAIRGLQRTTVQHLLDASNVSRRTFYKYFRNKMDVLESI
FT                   YRIFVDNMMLHFHREVKQASSVNDIIRNTTKVYFDHHVSMGPVIKLMMEEARSSDSALA
FT                   PHRIRAQTLASEVLAVQINRYTGKDYEPLVFLTVLWMLENYSLYIFDDGGFSQQRLDLC
FT                   LRVAVGVTESLVLGKAAPSMLERPA"
     atgtttactc tgctagggcc gttagttaag ctaccgaagg ctatagattt taaggggcgt        60
     cacgtgcaga gaccaagcag cgacatagat gcgattcgcc aggtggtgaa tcaagtgttg       120
     gaagttcatg ccctcgaaga aggagggcag cgctctcagg ctcgggctga aattctgatt       180
     cactcaatgc aggtgtttgc tattcgtggg ctccagcgaa ccacggtaca gcatttgtta       240
     gatgcctcta atgtatctcg acgcacgttc tacaaatact ttcgcaacaa gatggatgtg       300
     ctggaaagca tctatcgtat ctttgtggat aatatgatgc tgcattttca cagagaggtg       360
     aagcaggcct catctgtgaa cgatatcatt cgtaatacca ctaaggttta ttttgatcac       420
     catgtgagta tgggcccggt aatcaagttg atgatggagg aggctcgctc ttctgattca       480
     gctctggcgc ctcaccgcat ccgtgcccaa accttggcat ctgaagtcct agctgttcag       540
     attaaccgtt atacggggaa ggattacgag ccgttagttt tcctgacagt gttgtggatg       600
     ttagagaact actcactcta tattttcgac gatggcggct tttcccagca gcgactggac       660
     ctgtgcttgc gggtcgcggt gggtgtgact gaatccttgg tgctgggaaa ggctgcgcca       720
     agcatgttgg agcgccccgc gtag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page