(data stored in ACNUC7421 zone)

EMBL: AM286690.PE491

AM286690.PE491       Location/Qualifiers
FT   CDS_pept        complement(538964..539776)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15939"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSA9"
FT                   /protein_id="CAL15939.1"
FT                   /translation="MRITFVLAAVLAFSPLCVAYTQADSLDDTLDAPHRTSAEKARDSY
FT                   RHPAKTLRFFNVEADMAVVEIWPGSKGWYTAILAPYLRDNGTYYAAQFPPDSNIPFYQR
FT                   SLIQFKTRLAKQDEIYNKVRITHLYPPVYNDIAPAGTVDRVLTFRNVHNWAKSGKGEAA
FT                   FKSFYKALKPGGVLGVVEHRAPEVRPLERQIETGYMSEGYVIALAEKAGFTLVDRSEIN
FT                   ANPKDQINHPAGVWTLPPTLRLGDKDRETYEAIGESDRMTLKFLKPEH"
     atgcgcatca cgtttgttct agctgcggtt ctggcttttt ccccgctatg cgttgcatac        60
     acccaggccg acagcttgga cgatactctt gacgctcccc accgcacgtc agcggaaaag       120
     gcccgtgact cttaccgcca cccggccaag acccttcgct ttttcaacgt agaagccgac       180
     atggccgtgg tggaaatctg gcctggctca aaggggtggt ataccgccat tctggcgcct       240
     tatctgcgcg acaatggcac ttattatgct gcccaatttc cgccggatag caacatcccg       300
     ttttaccaac gttcactgat ccagtttaaa acccgcctgg ccaagcagga cgagatttac       360
     aacaaggttc gcattaccca cctttatccc cctgtctaca atgacattgc cccagcaggc       420
     acagtcgacc gggttctcac tttccgcaac gtgcataact gggcaaaatc cggcaagggg       480
     gaagccgcct tcaaaagctt ttacaaggct ctcaagccgg gcggagtgct gggcgtagtg       540
     gaacatcggg caccagaagt acgcccactg gaaaggcaaa tcgaaacggg atatatgagc       600
     gaggggtatg tcatcgccct tgccgagaag gccggtttta cactggtgga tcgatcagag       660
     atcaatgcca acccgaagga tcagatcaac caccctgccg gagtctggac acttcccccc       720
     actctacgac tcggcgacaa ggacagggaa acctatgaag caatcgggga aagtgaccgg       780
     atgacactga agtttctcaa gccggagcat tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page