(data stored in ACNUC7421 zone)

EMBL: AM286690.PE505

AM286690.PE505       Location/Qualifiers
FT   CDS_pept        554902..555402
FT                   /transl_table=11
FT                   /locus_tag="ABO_0505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15953"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS95"
FT                   /protein_id="CAL15953.1"
FT                   /translation="MKNFLTIILLSLVSVAVHGEEPGGKVAAAKEVLVASNAKAIFTEA
FT                   RKQIESMTDQALAKTIPADKKGMVERYKKRVQSILDEGLNWGAMEAQMLDIYQRTFSQK
FT                   EMQDMATFYQSESGQAIMKKMPKVMAESVQISQRQMQHVMPSLRQMFSDMEAELAHTEV
FT                   QKQ"
     atgaaaaatt ttttaacgat aatattgctg tctttggtgt cggtagccgt acacggtgaa        60
     gagccgggag gtaaggttgc agcagcaaaa gaggttttag tggccagtaa cgctaaagcc       120
     atttttactg aagcgcgcaa gcaaatagaa agtatgaccg accaggcgtt ggcgaaaaca       180
     attcctgctg ataaaaaggg catggtggaa cgttataaaa agcgtgtgca aagtattctt       240
     gatgaaggat taaattgggg cgccatggag gcacagatgc tggatattta tcaacggact       300
     ttttcgcaga aagagatgca ggatatggcc accttctatc agtcagaaag tggtcaagcg       360
     atcatgaaaa agatgccgaa agtgatggca gagtccgtgc agatttccca gcggcaaatg       420
     cagcatgtga tgccgtcctt gcggcaaatg ttctctgata tggaagctga gctggctcat       480
     actgaagtgc aaaagcaata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page