(data stored in ACNUC7421 zone)

EMBL: AM286690.PE506

AM286690.PE506       Location/Qualifiers
FT   CDS_pept        complement(555535..556740)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0506"
FT                   /product="aminotransferase, putative"
FT                   /note="(aminotransferase, putative) identified by sequence
FT                   similarity; putative identified by match to PFAM protein
FT                   family HMMPF00155 InterPro: Aminotransferases class-I"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15954"
FT                   /db_xref="GOA:Q0VS94"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS94"
FT                   /inference="protein motif:HMMPFAM:HMMPF00155"
FT                   /protein_id="CAL15954.1"
FT                   /translation="MGNSNLDTDFYESEDPIWNPALLTIPVPGIRRMVNLAADMDDVIH
FT                   LSIGQPDFKPPEHVIQAGVDALYAGQTGYTMDAGLPELLDSLAEYYSKRYQRTLVPENF
FT                   LVTTGATEALYLALTATSAPGREFIVPDPSFMLYGPLIRMNGGIVRSIATRAENNHQLD
FT                   PQEVIDAMGPNTFAVILNSPSNPTGTIYPRETIDAIVEEAAYRGIHVISDEVYDHLIYD
FT                   GKDYPSVLSSCPDLDHVMVISSFSKTFSMAGMRVGWLIGSQGAIKKLRRYHMFTTTVAN
FT                   TPCQWAGVAALRGSNQFIDSMVEEYQGRRDRLVELVEQTPHLTGYKPDGAFYLFPSLPE
FT                   GVDGANVALKLLRETGVCTISGDTFGDAGRNALRISYSTSLDQIEEAFSRIIPWMEKQN
FT                   FS"
     atgggaaaca gcaatctgga cacagatttc tacgaaagcg aagaccccat ctggaacccg        60
     gccctgctga ccattccagt gccaggtatc cgtcgtatgg tgaacttggc cgcggacatg       120
     gatgatgtca ttcatttatc catcggtcag cccgatttca aaccgccaga gcatgtaatt       180
     caggccgggg tggacgcact ttatgctggc cagaccggtt acaccatgga tgcgggccta       240
     cccgaactac tggactcttt ggccgagtat tacagcaagc ggtaccagcg caccctagtg       300
     ccggaaaact tcttagtcac caccggtgcc accgaagctc tgtatctggc attaaccgcc       360
     acctcggcgc ccggccgaga attcatcgtg ccggacccct ctttcatgct ctatggccca       420
     ctgatccgca tgaacggcgg catcgtgcgc agcattgcca cccgtgccga gaacaatcac       480
     caactggatc cgcaggaggt cattgatgcc atgggcccca acacctttgc ggtgatcctt       540
     aactcaccca gtaaccccac tggcaccatc tacccgcggg aaaccattga cgccattgtc       600
     gaagaagccg cctaccgtgg catccatgtg atcagcgacg aggtctacga ccatctaatt       660
     tacgatggaa aagattaccc tagcgtactc tccagctgcc cagacttgga tcatgtcatg       720
     gtcatcagca gcttctcgaa aaccttctcc atggcgggca tgcgtgttgg ctggctcatt       780
     ggcagccaag gggcgattaa aaaactacgc cgctaccata tgttcaccac caccgttgcc       840
     aacaccccct gccaatgggc cggcgttgcg gcactgcgtg gcagcaatca attcatcgac       900
     agcatggtag aggagtatca aggtcgccga gatcggttgg tagaactagt agagcaaacg       960
     ccgcacctaa ccggctacaa acccgacgga gccttctacc ttttcccttc attaccggaa      1020
     ggggtcgatg gcgctaacgt ggccctgaaa ttactgcgcg aaaccggggt ctgtactatt      1080
     tctggcgata cctttgggga cgcaggccga aatgccctac gtatcagtta ttccacatca      1140
     ttggatcaga tagaagaagc ctttagccga attattccct ggatggaaaa acagaacttc      1200
     agctga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page