(data stored in ACNUC7421 zone)

EMBL: AM286690.PE513

AM286690.PE513       Location/Qualifiers
FT   CDS_pept        564704..565489
FT                   /transl_table=11
FT                   /locus_tag="ABO_0513"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /EC_number="2.1.1.-"
FT                   /note="RNA methyltransferase TrmH family group 1 identified
FT                   by match to PFAM protein family HMMPF00588 InterPro: RNA
FT                   methyltransferase TrmH family group 1"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15961"
FT                   /db_xref="GOA:Q0VS87"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS87"
FT                   /inference="protein motif:HMMPFAM:HMMPF00588"
FT                   /protein_id="CAL15961.1"
FT                   /translation="MLENVRIVMVETSHPGNIGAAARAMKTMGLSDLRLVQPQSYPSVE
FT                   ATARASGAGDVLEAAQVCNSVDEALEGATLVIGTSARQRRIPWPCLTPRQLAAQLSHDL
FT                   ANAPQDTRIAVLFGREDRGLTNDELRRCNLHVSVPANPEYGVLNVASAVQLISYELRLA
FT                   LLGDDFELQESRSRREVMPLPEMFWDEPPATNEAVSGFLDHLEKVMAQSGFLNPQQPGQ
FT                   VMTRMRRLFMRARPDKMEMSILRGVLVALEKKMQRDEGR"
     atgttggaaa atgtgcgcat cgtgatggtg gaaacctccc accccggcaa tatcggcgcg        60
     gctgcccggg ctatgaaaac catgggcctg tcggacttgc ggttggtgca gccacagtcc       120
     tatcccagcg tggaggcgac cgcccgtgcc tccggtgccg gggacgtgct ggaggcggcg       180
     caagtgtgca acagcgtgga tgaggcgctg gaaggcgcca ctttggtgat cggtactagc       240
     gcgcgccaac gccgtattcc ctggccctgc ctgacgccgc gccagttggc tgcacagctc       300
     tcccacgatt tggccaatgc gccgcaggat acccgcattg cggtgttgtt cggtcgtgag       360
     gaccgggggc tgaccaacga cgagctgcgc cgctgcaatc tccacgtgag tgtgcccgct       420
     aatccagagt atggggtctt gaatgtggcg tcggcggttc aattaatcag ttacgagttg       480
     cgtcttgcgt tgttggggga tgatttcgag ttgcaggaat ctcgctcccg ccgtgaagtg       540
     atgccactgc cagaaatgtt ctgggatgaa ccgccggcca ccaatgaagc ggtctctggt       600
     tttctcgatc atttggagaa ggtgatggca cagagtggtt ttttaaatcc gcaacagcca       660
     ggtcaagtaa tgacacgcat gcgtcgtttg ttcatgcgcg ctcgcccgga caaaatggaa       720
     atgagcattt tgcgcggcgt attggtggcg ctggagaaaa aaatgcagcg tgatgagggc       780
     cgatag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page