(data stored in ACNUC7421 zone)

EMBL: AM286690.PE520

AM286690.PE520       Location/Qualifiers
FT   CDS_pept        complement(571213..571800)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0520"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="outer membrane lipoprotein LolB identified by match
FT                   to PFAM protein family HMMPF03550"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15968"
FT                   /db_xref="GOA:Q0VS80"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS80"
FT                   /inference="protein motif:HMMPFAM:HMMPF03550"
FT                   /protein_id="CAL15968.1"
FT                   /translation="MTLSLARIIGLTLTTLVLGACQLRPTTTTQFEHPSQIQQWQMNGK
FT                   LGYRTVNDGGSATFDWRQQPQRGNIHFSGPLGFGSADLHWDSGRAELITAKETYQARSP
FT                   GELAWHLTGFWLPVSALQYWARGLPWPGAPSEAGYDDQQRLITLEQLGWSLTFDRYEPT
FT                   AGITLPYRIKAQQNSNRFTLLIKDWQPGGGAQ"
     gtgaccctga gccttgcccg cattattggc cttacgctga ccaccctggt cctaggcgcc        60
     tgccaattac gcccgaccac cacaacccag ttcgagcacc ccagccagat ccaacagtgg       120
     cagatgaatg gcaagctggg ttaccgcacc gtcaacgatg gtggcagtgc cacctttgac       180
     tggcgccagc aaccacaacg gggcaacatc cacttctccg gcccgctggg ctttggtagc       240
     gccgatttac attgggacag cggccgcgcg gaactaatca ccgccaagga aacctaccaa       300
     gcccgcagcc ccggcgagtt ggcctggcat ctcaccggct tctggctgcc cgtatccgca       360
     ctgcagtact gggctcgcgg cctgccttgg cccggcgcac cctctgaagc cgggtacgac       420
     gatcagcaac gcctgatcac ccttgaacag ctgggctggt cgcttacctt cgaccgttac       480
     gaacccaccg ccggcatcac ccttccctac agaatcaaag cccagcagaa tagcaatcgc       540
     tttactttgc tgattaaaga ctggcagcca ggcggcggcg cacagtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page