(data stored in ACNUC7421 zone)

EMBL: AM286690.PE534

AM286690.PE534       Location/Qualifiers
FT   CDS_pept        586232..590053
FT                   /transl_table=11
FT                   /locus_tag="ABO_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15982"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS66"
FT                   /protein_id="CAL15982.1"
FT                   /translation="MVLTRFARWRRFFPSLWWTVATVLLLMAAYVVVGRQLMLLVPDYR
FT                   ERLEQIFEKRIQTPLTIAELNGTMSGLVPQFVARQIRLPAPEGEAPLVLGEVVLSIDVL
FT                   RSLWHRDLVLEELSVRGVDLSLVRGDDGKIRLRGLDVLGQSDPDNRPPLERILKLFYRQ
FT                   QLLSISDARLSLEWPGMPPLAASELDATMTNDGDEHRLAVRVEARDRPLSLLAKIHLHE
FT                   DAYTLDQVDADIFTRFEGKRLNEWLPQIDAMPLELGSLDASVALWGTLQGGEPTSGQLQ
FT                   VDVPALTLFQADTVLPLSGLSLRASLLREDQKATLSLSNLTGNSPTGPLTLGDMALRWE
FT                   TQGERREWQLRANALPLHAITQQFKDWPFTLPKLASEWREKIAVASPRGVVEGVYLSGH
FT                   ARDLEQFQVRFAGLASEADDNIPGVKGLNGWVAGSPNQGLAHLYSDNVSLQLPRLYDHA
FT                   LGGQLAGVFGWQREGEALSVRSSRLRVVNPDAYGEAMMAVTLRPGEIPELRLAAEIYDG
FT                   NGARASHYIPLKPLPDGLSGWLSQAIGDGHLQRGQLLYQGPVKIDKSRQQDRTFQMRYQ
FT                   ADDVRLSFLPDWPEATGVKADVWVNGREVQGVASQGSLLNSQLTEVHVDVPAFDDESGP
FT                   SVIVAGQVSGPLEDLDTVFQNTPLAEQLPQEVKDWRYLGGNMKGQLTLNIPLKKGSTSP
FT                   MVIVNASVADGQVENRERNLLITDVQAPVYFHLRNGLQMSRLSASTLGGEVTGKWITGS
FT                   GKSTLTLDGEVPVESLRNWLGFDWLAPASGSLPLAMAIQVPWQGNSFALHATSSLKGVI
FT                   VDAPVPLGKTASQSRNLALDLTHNGQHLALQYGDTVRGAFALNETVRGGVRLGVGTPHI
FT                   PASGIDVQGRLARASAQAWIDFVSNELLPAMDSNASGGGGNGAQQGGLNKVNVQVATLD
FT                   LFGVDVSEASLSVLPRANGWDLALSSPSVAGSVAIPEGFSARGKVPLDLSVSRMNLTLP
FT                   DSADPQSGAPLSPMDLPSVNARLANLRIDGEDFGQWQAELRPTEQGLRINDLQGRWRAS
FT                   RILGTVDWTEDDGAQYTRFNGSLTSDNLGRSLRAWGLPEMIESEDATAKVSLGWAQWPL
FT                   APNYLALNGQARVDIGECRIPDTDTKTSFLRLLGILNLGTIQRRLRLDFSDLYKKGLSC
FT                   DSITGDFALDGPHVSTSNLAIDSPSAAIRVKGTINLEKETLNHQMEVTLPLSSNLYAGC
FT                   LAGPAACAGIFVVERIWGDELDKTATMEYRVSGSWSGPDVSETEGIFE"
     atggtattga cccgcttcgc acgctggcgc cgattttttc cttccctgtg gtggacggtc        60
     gcgacagttt tattgctgat ggccgcttac gtggtggtgg ggcgtcagct tatgttgttg       120
     gtgcccgatt accgtgagcg ccttgagcag atatttgaaa aacgtatcca gaccccacta       180
     accattgccg agctgaacgg caccatgtcc gggttggtgc cacaatttgt ggctcgccag       240
     attcgcctgc cagcccccga aggcgaagcg cctttggtgc tgggcgaagt ggtgcttagc       300
     atcgatgtct tgcgctcctt gtggcaccgg gatctggtgc ttgaagagct cagtgtgcgc       360
     ggtgtcgatt tgagtctggt gcgcggcgat gacggcaaga ttcgtctacg agggttggat       420
     gtgcttgggc aaagtgaccc tgataatcgt ccaccgttgg aacgtattct aaaattgttt       480
     tatcgacagc aattactgtc gatcagcgat gcacggctgt ctttagagtg gccaggaatg       540
     ccaccgttgg cagcatccga gctggatgcc accatgacca acgatggtga cgaacatcgg       600
     ctggcggtgc gggtggaggc ccgtgatcgg cccctgtctt tgctggcaaa aattcacctg       660
     catgaagatg cctacacgtt ggatcaagtg gatgcggata tttttactcg ctttgaaggc       720
     aagcggctga acgaatggtt gcctcaaatc gacgccatgc cgctggaact gggctcgctg       780
     gatgcgtctg tagccctatg ggggacactg cagggggggg agcctacctc cgggcagctg       840
     caggttgatg tgcctgcact gacactattc caggcagata cagtgttgcc tttgagtggc       900
     ctgtcgttgc gggcatcgct gctgcgtgag gaccagaagg ccacgttgtc gctatccaat       960
     ttgacaggaa actcacctac cggtccgctg acgctggggg atatggcgtt gcgatgggaa      1020
     acccagggcg agcggcgtga atggcagctg cgggccaatg cgttgccctt gcatgccata      1080
     actcagcaat tcaaagactg gccgtttacg ttgccgaaat tggccagtga atggcgtgaa      1140
     aaaatagcgg tggcgtcccc ccggggagta gtggaagggg tgtatctgag cggtcatgcg      1200
     cgagacttgg agcagtttca ggtgcgtttt gctgggctgg cgagcgaggc ggatgacaat      1260
     atccctggtg ttaaggggct gaatggctgg gtggcagggt ctccgaatca ggggttggcg      1320
     cacctttaca gtgacaatgt gtcgctgcaa ttaccgcgac tgtacgatca tgcactgggc      1380
     ggccaactgg ccggcgtgtt tggttggcag cgggagggcg aggcgctctc ggtgcgctcc      1440
     agccgcttgc gggtggtgaa cccagatgcc tacggcgaag ccatgatggc cgttaccttg      1500
     cgcccgggag aaattcccga gctgcgtctg gccgcggaaa tttacgatgg aaatggcgcg      1560
     cgggccagtc actacattcc cctgaagccg ctcccggatg ggctgtccgg gtggttgtcg      1620
     caagcgattg gcgatggtca tcttcagcgc gggcaattgc tctatcaggg gccggtaaaa      1680
     atcgacaaaa gtcgacagca ggaccgcact tttcagatgc gctatcaggc cgacgatgtg      1740
     cgcctgtcgt ttctgccgga ctggccggag gccactggtg ttaaggcgga tgtgtgggtt      1800
     aatggtcgtg aggtgcaagg agtggccagc caagggagcc tgttgaatag tcagctcacc      1860
     gaggtgcatg tagacgtgcc cgcttttgat gatgagagcg gccccagcgt gattgtggcc      1920
     ggccaagtca gtggtccgct cgaagacctg gatacagtgt ttcagaacac gccgttggct      1980
     gagcagctcc cccaagaggt aaaagactgg cgctatctgg gcggtaacat gaaagggcag      2040
     ctgaccctga atatcccact caagaaaggg tcgacctcgc ccatggtgat cgtgaatgcg      2100
     tccgtggctg atgggcaggt ggaaaaccgt gagcgtaatt tgcttatcac cgacgtacag      2160
     gcgccggtat attttcattt gcgtaacggg ctgcaaatgt cacggcttag cgcctccact      2220
     ttgggcggcg aggtgacggg taaatggatt accggatcgg gtaaaagcac gctgaccttg      2280
     gatggcgaag tgccggtgga gtcgttgcgc aattggttgg gcttcgattg gctggcgccg      2340
     gccagtggct cgttaccgtt ggctatggca atccaagtgc cttggcaggg aaattctttc      2400
     gccctgcatg ccacctcttc acttaagggc gtcatagtgg atgcgcctgt tccgctgggg      2460
     aagacggcct ctcaatcgcg gaatctggcg ctggacctta cccataatgg tcaacatctg      2520
     gcgttacaat atggtgatac cgtgcgcggc gctttcgctc ttaatgaaac cgtgcggggt      2580
     ggggttagac tgggtgtcgg tactccacac atccctgctt ccggcatcga tgtgcagggg      2640
     cggttggctc gggccagcgc gcaagcgtgg attgatttcg tcagcaatga gttgctgcca      2700
     gccatggact cgaacgcttc gggcggtggc ggtaatgggg cccagcaggg tgggttgaac      2760
     aaggttaatg tgcaggtggc cacactggat ttgtttggtg tggatgtgtc ggaggcaagt      2820
     ctgtccgtgt tgcctcgtgc taatggttgg gatctggcgt tgagcagccc gtccgtggcc      2880
     ggctcggtgg ccatccctga agggttttcg gcccgaggca aggtgccgct cgatctatcc      2940
     gtctcgcgga tgaacctgac tttgccagac agcgctgatc cacaatccgg cgcgcccttg      3000
     tcgccaatgg atttgccgtc ggtaaacgcc cggttagcta atttgcgtat cgatggcgag      3060
     gattttggcc agtggcaggc ggaactacgc cccacagagc aggggctgcg aatcaatgat      3120
     ttgcaaggcc gttggcgggc tagccgcatt ctgggcacgg tggactggac ggaggatgac      3180
     ggcgcccaat acacccgctt caatggctcg ctgacgtcgg acaatctggg ccgttcattg      3240
     cgcgcctggg ggctaccgga aatgattgaa tcagaagatg ccacagccaa ggtgtcgcta      3300
     gggtgggcgc aatggccgtt ggcgccaaac tatcttgccc tgaacggtca ggcccgggta      3360
     gatattggtg aatgccggat acccgatacc gataccaaaa cgtcgttctt gcggctgttg      3420
     gggatcctca atctgggcac catccagcgt cgcttgcgac tggatttctc tgatctgtat      3480
     aaaaaaggct tgagttgcga cagcatcacc ggggacttcg ccctcgacgg gcctcatgtg      3540
     tctacaagca acctagcgat tgattcgcct tctgcggcaa ttcgcgtgaa agggacgatc      3600
     aatcttgaaa aagaaaccct gaaccatcaa atggaagtca cgttgcccct gtccagtaac      3660
     ttgtatgctg ggtgtttggc tggacctgct gcgtgtgccg gtatctttgt ggtagagcga      3720
     atatggggcg atgaattgga caagaccgcg accatggagt accgagtaag tggtagctgg      3780
     tcgggccccg atgtgtctga gacagaaggg attttcgaat ga                         3822
//

If you have problems or comments...

PBIL Back to PBIL home page