(data stored in ACNUC7421 zone)

EMBL: AM286690.PE538

AM286690.PE538       Location/Qualifiers
FT   CDS_pept        592730..594328
FT                   /transl_table=11
FT                   /locus_tag="ABO_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="(MORN domain protein) identified by match to PFAM
FT                   protein family HMMPF02493 InterPro: MORN motif The MORN
FT                   (Membrane Occupation and Recognition Nexus) motif is found
FT                   in multiple copies in several proteins including
FT                   junctophilins. The function of this motif is unknown."
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15986"
FT                   /db_xref="GOA:Q0VS62"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS62"
FT                   /inference="protein motif:HMMPFAM:HMMPF02493"
FT                   /protein_id="CAL15986.1"
FT                   /translation="MLACYALTCVVHRPSWHNLNCRWVNEEPLLMRTLCLFVWLMLLAA
FT                   CDPGQLPADVRLPDGAVYEGDVKSNLFHGEGTLTWPGGRRYKGEFQDGLMTGEGRLEER
FT                   DGCVQEGQFVNGVLNGEGAYTCQDASWQGEFKDGELIKGSVEYLDDNSYQGEFRDFQPH
FT                   GQGLWVTASGEQFEGTFADGYMVKGSYRNDEGYHYQGEFDFFTFEGKGVLTRPDGAVIR
FT                   ADFEKGKAQGPGTRTRFDDGGTAVVEKGFFVRGDYYPSEKAWRQRKQRQAAAMEARLYT
FT                   ESSRLQSVLSSLAPQRPGVRDVYLLVVGGDGTEAVFAREVDWVAQRLDSVFNLKRRHVR
FT                   LINGGSDDLPLATRTSIQESLKALDALMDPNEDLLLMHVVSHGSPNGDLVLDDKSLKLN
FT                   NLSVADGKAWLDELAARHQWLVVSACYSGKWVESLASPERVVFSSAAADRTSFGCGDDS
FT                   ERTWFSKALYGEAMLAGVQDPDAWFEAAEENVSLMEKERGTEDDDLSLPQKSVGGNFLQ
FT                   WWQADKTAVVIPVRP"
     ttgctcgcct gttatgcact cacctgcgtc gtacatcgtc ccagctggca caatttaaac        60
     tgccggtggg ttaatgaaga gccgttgctt atgagaacgc tttgtctgtt tgtgtggcta       120
     atgttgctgg cggcctgtga tccgggacag ttacctgcgg atgtgcggct gcccgatggc       180
     gctgtgtatg aaggtgatgt aaagagcaat ttgtttcacg gtgagggcac tctgacttgg       240
     cccggtggcc ggcgttataa gggggagttt caggacgggc taatgaccgg cgagggtcgg       300
     ttggaggaac gcgacggttg tgttcaggag ggccagttcg ttaatggtgt tcttaatggc       360
     gaaggcgctt acacctgcca agatgcttct tggcagggag agttcaaaga tggcgaactg       420
     attaaaggct cagtggaata tctggatgat aattcctacc agggtgaatt tcgcgatttt       480
     caaccccatg ggcaggggct gtgggttact gcatccgggg agcagtttga agggacattc       540
     gccgatggct acatggtcaa aggttcctac cgcaacgatg aaggctatca ttatcagggt       600
     gaatttgatt tttttacctt cgagggaaaa ggtgttttga cccgcccgga cggcgccgtg       660
     attcgggccg attttgaaaa gggcaaagcg caaggccctg gcacccgcac tcgtttcgat       720
     gatggaggaa cggcggtggt ggaaaagggt ttttttgtgc gaggtgacta ttaccctagc       780
     gaaaaggcct ggcgtcagcg taagcagcgg caggcggcag ccatggaagc gaggctgtac       840
     acggaatcaa gccgtttgca gtcggtgttg tcgtcactgg cgccccagcg gccgggcgtg       900
     cgtgatgtct atttattggt ggtgggcgga gatggcactg aagcggtgtt tgcccgtgaa       960
     gtggattggg tcgcacaacg gctggactct gtgtttaatt tgaagcggcg gcacgtgcgt      1020
     ttgattaatg ggggcagtga tgatttgccc ttggccaccc gaactagtat ccaggaaagc      1080
     cttaaagcgc tggatgcctt gatggaccca aatgaagatc tgttactgat gcatgttgtt      1140
     agccacggat cgcccaacgg ggatttggta ctggatgata agagcctcaa gctcaataat      1200
     ctttctgttg ctgatggtaa ggcgtggctg gatgagcttg ctgctcgtca tcaatggctg      1260
     gtggtgtcgg cctgttactc gggtaaatgg gtggaaagct tggcttcacc ggagcgagtg      1320
     gtgttttcct ctgctgcggc ggaccgtacc tcgtttggtt gtggtgatga ttccgagcga      1380
     acttggttca gtaaggcgct gtatggcgaa gcaatgctgg ccggggtcca agaccccgac      1440
     gcctggtttg aggcggctga agaaaatgtc tcgctcatgg aaaaggagcg gggcaccgaa      1500
     gatgacgacc tatccttgcc ccagaaatcc gtcggcggga acttcttgca atggtggcag      1560
     gcggataaaa ctgcagtggt gattccggta aggccctga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page