(data stored in ACNUC7421 zone)

EMBL: AM286690.PE539

AM286690.PE539       Location/Qualifiers
FT   CDS_pept        complement(594355..594894)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by sequencesimilarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15987"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS61"
FT                   /protein_id="CAL15987.1"
FT                   /translation="MTEYSDEQITSKGQQKREDNALQELGLLLMDMKQVERERLPLRDD
FT                   LQYALAEATRITSHEARRRHAQYIGRLIRETNSEQIIKALELLNDPFRQQRLSNWVEQI
FT                   VACEQLKDAGATLQQILEFFPHGDRQQLRNLTRNALKAQVEDPATASTAEKDKFKRERR
FT                   KLINYLNQLDKTAPLY"
     atgaccgagt atagcgacga gcaaatcacc agcaagggcc agcaaaaacg cgaagacaat        60
     gccttgcaag aactgggtct gttactgatg gacatgaaac aggtagagcg cgaacgcttg       120
     cccctgcgtg acgatctgca atatgcgctg gctgaagcta cccgcatcac cagtcatgag       180
     gcccgccgac gtcacgctca atacatcggc cggctcatcc gcgagactaa cagcgaacag       240
     attatcaaag cattggaatt gctcaatgat ccctttcgac aacagcggct cagcaactgg       300
     gtcgagcaga ttgttgcatg tgaacagctg aaagacgcgg gagccaccct acaacaaatt       360
     ttggaattct ttcctcacgg cgaccgtcag caactacgca atctcacgcg caatgccctg       420
     aaagctcaag tcgaagatcc ggccacggct tccacggcag aaaaagacaa attcaaacgc       480
     gaacgccgca aactgatcaa ttacctcaac cagctggata aaaccgcacc gctgtactga       540
//

If you have problems or comments...

PBIL Back to PBIL home page