(data stored in ACNUC7421 zone)

EMBL: AM286690.PE553

AM286690.PE553       Location/Qualifiers
FT   CDS_pept        complement(612457..613182)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0553"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /function="Transport: unknown substrate"
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR00968 InterPro: AAA ATPase superfamily"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16001"
FT                   /db_xref="GOA:Q0VS47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS47"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00968"
FT                   /protein_id="CAL16001.1"
FT                   /translation="MSHLRAHHLAKSYKGRRVIEDVSLDVEAGQIVGLLGPNGAGKTTC
FT                   FYMIVGLVEADAGRIEINDTDITHLPMHGRAQRGIGYLPQEASIFRRLTVEENIMAILE
FT                   TRKELSKAERHERMEGLLKEFHIGHIRDSLGMSLSGGERRRAEIARGLATDPDFILLDE
FT                   PFAGVDPISVNDIKGIIRHLKERGIGVLITDHNVRETLDICDTAYIVSAGHIIASGDAD
FT                   IILANQQVRDVYLGADFRL"
     atgagccatt tacgcgccca tcacctagca aaaagctaca agggtcgccg ggttatcgaa        60
     gacgtttccc tggatgtaga agccggccaa attgtcgggc tactggggcc caatggggcc       120
     ggcaaaacca cctgcttcta catgattgtt gggctagtgg aggccgatgc cggtcgcatt       180
     gaaatcaacg acacggacat tacccacctg cctatgcacg gtcgcgccca gcgggggatt       240
     ggctacctgc ctcaagaagc cagtatcttt cgccgtctaa cggtggaaga gaacatcatg       300
     gccatcctag aaacccgcaa ggagcttagc aaagcagaac gccacgagcg catggaaggc       360
     ctgctcaagg aattccacat cgggcacatc cgcgattcgc tggggatgag cctgtccggc       420
     ggcgagcgcc gccgcgcgga aatcgcccga ggcttggcca cagaccctga cttcattctg       480
     ctggacgaac cttttgctgg cgttgacccc atctcggtta acgacatcaa aggcatcatt       540
     cgccacctca aagaacgcgg catcggcgtc ttaatcaccg accacaatgt acgcgagacc       600
     ctggatatct gtgacaccgc ttatatcgtc agcgctggcc acatcatcgc ctccggtgac       660
     gcggatatta tccttgccaa ccaacaagtg cgagacgtct atctgggcgc cgatttcaga       720
     ctataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page