(data stored in ACNUC7421 zone)

EMBL: AM286690.PE555

AM286690.PE555       Location/Qualifiers
FT   CDS_pept        complement(613753..614310)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0555"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16003"
FT                   /db_xref="GOA:Q0VS45"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS45"
FT                   /protein_id="CAL16003.1"
FT                   /translation="MKRQGLLSATGILLLGLVMLMTLHEWDSALPGQDNAVAMAPAIIA
FT                   DQVSARAFSEKDGSLQYHLTADSLVQFDHNPLTKMQAPVLIMANDKGSWTITSEQGIVQ
FT                   EDGDLISFLGKVNVNNPIQKMTVNTEELHFNSDTNIATTPGDVEMRFDSGQTRAGALEA
FT                   DLNKGVLELKQGVKSEFEAPAS"
     atgaaacgtc aggggctatt aagtgccacc ggcattctgc tgctggggct ggtgatgctg        60
     atgaccctgc acgagtggga cagcgctctg cctggccaag acaatgcggt ggctatggca       120
     ccggcaatca ttgctgacca ggttagcgcg cgagccttca gcgaaaaaga tggtagcctg       180
     cagtaccact taactgcgga cagtttagtg cagttcgacc acaatccgct caccaagatg       240
     caagccccag tactgatcat ggccaacgac aaaggcagct ggaccatcac tagcgagcaa       300
     ggcatcgtgc aagaagacgg cgacctgatc tcttttcttg gcaaggtcaa tgtgaataat       360
     ccgatccaga aaatgaccgt gaatacagaa gaactgcatt tcaacagcga cactaacatc       420
     gccaccaccc ccggcgacgt agaaatgcgg tttgactccg gccagacccg tgctggcgcc       480
     ctggaagcag atctcaacaa gggcgttctg gaactaaaac aaggagtaaa gagtgaattt       540
     gaagcaccgg cttcatag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page