(data stored in ACNUC7421 zone)

EMBL: AM286690.PE558

AM286690.PE558       Location/Qualifiers
FT   CDS_pept        615988..616635
FT                   /transl_table=11
FT                   /locus_tag="ABO_0558"
FT                   /product="toluene-tolerance protein"
FT                   /note="(ttg2D) identified by sequence similarity; This
FT                   family is a transporter which shows similarity to ABC
FT                   transporters"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16006"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS42"
FT                   /protein_id="CAL16006.1"
FT                   /translation="MHLQWYMAAWLRVGLVVMLTAMAALVQAQSDPRQVVADAVERMTS
FT                   RVEAERETLKADPDRAKELVREELADLVDFKRITRMVMGDYFGPSSKEQKYRFLDVFKN
FT                   SLINTYASGITLYDGQKIDILPMQDGDRKGDYARVRMEVKTNSGQVVPIYYTLFLRDDQ
FT                   WRVINVYVNGLDLRDTFKSQFAQGMQQYNDIDKVVDNWSADAKIDAGLKEEG"
     atgcatttac aatggtatat ggccgcctgg cttcgcgtcg ggttggtggt catgctgacc        60
     gcaatggcag cactggtcca ggcccagagt gatcctcgcc aggtggtggc ggatgcagtg       120
     gagcgcatga cgtctcgtgt tgaggcggag cgagagacgt tgaaagccga tccggatagg       180
     gccaaagagc tggtgcgtga agagctggcg gatctggtgg atttcaagcg catcacccgc       240
     atggtcatgg gcgattactt tgggccgtct agcaaggagc agaaataccg gtttttggat       300
     gtcttcaaaa acagcttaat caacacctat gcgtccggca ttaccctgta tgacggacag       360
     aaaatcgaca tcttgccaat gcaggatggc gatcgtaaag gcgattacgc ccgagtgcgc       420
     atggaagtga agactaactc cggccaggtg gtgcccatct actacaccct attcttgcgt       480
     gatgatcagt ggagggtaat caatgtgtac gtgaatggtc tggatctgcg agacactttc       540
     aaaagccagt tcgcccaagg catgcaacag tacaatgata tcgacaaagt ggtcgataac       600
     tggtctgcgg atgccaaaat tgatgcgggc ctaaaagaag aaggctag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page