(data stored in ACNUC7421 zone)

EMBL: AM286690.PE56

AM286690.PE56        Location/Qualifiers
FT   CDS_pept        58413..58958
FT                   /transl_table=11
FT                   /locus_tag="ABO_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15504"
FT                   /db_xref="PDB:3H35"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTF8"
FT                   /protein_id="CAL15504.1"
FT                   /translation="MLHGLKQRLEALHHPGELEGSPQNLHQLLGVSIEQSVPQAQTMLV
FT                   ERHLASLTGDEARLLAALSDGSAFALLTLYSGSRFSRGEVLYRYSNAGRAAGIQCNDFI
FT                   ALYLNHLFAQGLVIASDFTESLRTDYELCEGDSDFRKAQAELQIHLPKLSIRRETLRIS
FT                   PLGRQLWTLMTTPADIEE"
     ttgttgcacg ggctaaaaca gcgcctggaa gcacttcatc atccaggtga attggagggt        60
     agcccgcaaa acttgcatca attactgggt gtgtccatag agcagagcgt tccccaggca       120
     cagaccatgc tggttgaacg gcatttggcg agcttaaccg gtgatgaagc tcgattgctg       180
     gcggcgcttt cggatggcag tgcctttgcg cttctcacgc tttatagcgg cagtcgcttt       240
     tcccgtggcg aagtcctcta ccgttattcc aacgccggcc gggctgcggg tattcaatgt       300
     aacgacttca ttgctctgta cctgaaccat ttgtttgctc aagggctagt tatcgctagc       360
     gatttcaccg aatcgctgcg aacggattac gaattgtgtg aaggcgacag tgattttcgt       420
     aaggcgcagg cagagttgca aattcacttg ccgaagctgt ctatccgcag ggaaaccctg       480
     cgaattagtc ctttgggtcg ccagttatgg acgttaatga ccaccccggc ggacattgag       540
     gagtag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page