(data stored in ACNUC7421 zone)

EMBL: AM286690.PE574

AM286690.PE574       Location/Qualifiers
FT   CDS_pept        complement(632772..633602)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16022"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS26"
FT                   /protein_id="CAL16022.1"
FT                   /translation="MIACAAIDAIVDGLFITVAISSLKGLPLSKKCSWAKLCTCLSGSL
FT                   LGFSAPWPSRWHCTRRTVVRLPEADGEPLGQWGHGAPAHRLLVVGESTAAGVGVLHHHQ
FT                   GLASQLALQLHQQSGQAVAWHTFGVNGIRVEELLARLADTALPPVDQIFISMGVNDTTG
FT                   FTSRRRYRIGLLQLIEALSKQHPHIRITLLAVPPMHKFTALPILLRQLLGWRARQLDQQ
FT                   HRRVARNVSLARYLDYPALQDPALLAKDGYHPNASGYRAMAAALTEQKSSKQKT"
     gtgatagcct gtgccgcaat cgacgctatt gttgacggcc ttttcatcac cgtagccatc        60
     agcagcttaa aaggcctgcc gctgtcgaaa aaatgttcgt gggcgaagct atgcacctgc       120
     ctttctggtt cacttttggg attctcagcc ccgtggccat cccgttggca ctgtacacgc       180
     cgcaccgtgg tacggctacc cgaagccgac ggcgagccct tgggccagtg gggccatggc       240
     gccccagccc atcgcttact ggtagtcggc gagtccacag cggcaggcgt gggcgtcctt       300
     caccaccatc agggactggc cagccaactg gccctacagc tgcaccaaca atccgggcag       360
     gcggtagcct ggcacacctt tggcgttaac ggcatccgtg tggaggaact actcgcccgc       420
     cttgctgaca cggccctacc tccagtggat cagatattca tcagcatggg agttaatgac       480
     accacaggct tcacttcccg gcgccgctat cgcatagggt tactgcagct gattgaggca       540
     ctgagcaagc aacatcccca catccgaata accttactcg ccgtgccccc catgcataaa       600
     tttaccgccc ttcccatcct gctcaggcag ctactcggct ggcgcgcccg acaactggat       660
     caacagcacc gtcgcgtggc ccgcaatgtc agcctcgcgc gctacctcga ttatcctgct       720
     ctgcaagacc ctgccctgct cgctaaagac ggctaccacc caaacgccag cggctaccga       780
     gccatggcag ccgcactgac agaacaaaag agcagcaaac aaaaaacgtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page