(data stored in ACNUC7421 zone)

EMBL: AM286690.PE587

AM286690.PE587       Location/Qualifiers
FT   CDS_pept        643649..644476
FT                   /transl_table=11
FT                   /locus_tag="ABO_0587"
FT                   /product="tetrapyrrole methylase family protein, putative"
FT                   /function="This family uses S-AdoMet in the methylation of
FT                   diverse substrates"
FT                   /note="(tetrapyrrole methylase family protein) identified
FT                   by match to PFAM protein family HMMPF00590 InterPro:
FT                   Uncharacterized protein family UPF0011 Methylase function:
FT                   Catalysis of the transfer of a methyl group to an acceptor
FT                   molecule"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16035"
FT                   /db_xref="GOA:Q0VS13"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS13"
FT                   /inference="protein motif:HMMPFAM:HMMPF00590"
FT                   /protein_id="CAL16035.1"
FT                   /translation="MSGILFIVSTPIGHLDDITRRAVDVLAAVDWIAAEDTRHSQRMLD
FT                   QLGIRNRMISCHDHNESQRSDELVSRLLGGEQGALISDAGTPLISDPGYRLVRACQEAG
FT                   VSVVPIPGASALLAALAAAGQPSDRFLFEGFVPAKGATRQQAIARLAGLSVTSIIYEAP
FT                   HRVLSFLETLKSLVEKDREITLCRELTKQFETIRRGPVAEICDWVASDSNQRRGELVLV
FT                   LSPQVHSSAWTEKDEALAKTLLAELPVSRVAKILAAHTGLKRQELYVLLEEMG"
     atgagcggga ttttgtttat tgtcagtacg ccgatcggtc atttggatga tattacccgt        60
     cgtgcggttg acgtactggc tgcggtggat tggattgcag cagaggatac tcggcacagc       120
     cagcgcatgc ttgatcagct aggtatacgc aatcgcatga ttagttgtca tgaccacaat       180
     gaaagccagc gtagtgatga actggtgagc cgtttgctgg gtggtgagca gggggctctg       240
     atcagtgatg cgggcacgcc attgatcagt gatcccggct acaggttggt tcgcgcttgt       300
     caggaagcgg gagtgagtgt tgtgccgatt cccggtgctt ctgccttgtt ggcggcgttg       360
     gctgcggcgg gtcagccttc tgatcgtttc ttatttgagg gctttgtgcc tgccaagggg       420
     gcgacgcgtc agcaggctat tgcgcgactg gcgggcctct ccgtcaccag cattatttat       480
     gaagcgcctc accgtgtgct gtctttcctt gaaacattga aatcgctggt tgaaaaagat       540
     cgtgaaatta ccctatgccg tgagctgacc aagcaatttg agacgattcg gcgtggcccg       600
     gtggcggaaa tctgcgactg ggtggcatca gatagtaatc aacgtcgcgg tgagttggtg       660
     ctggtgttgt cgccgcaggt ccactcctca gcatggacag aaaaggacga agcactggcc       720
     aaaacgctgt tggcggaatt gccggtgtcg cgggtggcaa aaatcttggc ggcccatacc       780
     gggttgaagc ggcaggaact gtatgtgctg ttggaagaga tgggttga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page