(data stored in ACNUC7421 zone)

EMBL: AM286690.PE589

AM286690.PE589       Location/Qualifiers
FT   CDS_pept        646221..646661
FT                   /transl_table=11
FT                   /locus_tag="ABO_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="(conserved hypothetical protein TIGR00242)
FT                   identified by match to PFAM protein family HMMPF02381
FT                   InterPro: Domain of unknown function UPF0040"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16037"
FT                   /db_xref="GOA:Q0VS11"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS11"
FT                   /inference="protein motif:HMMPFAM:HMMPF02381"
FT                   /protein_id="CAL16037.1"
FT                   /translation="MFTGSAALNLDAKGRLTMPTRYRASLIDTCGGQLVLTLHPFDDCL
FT                   ALYPRAEFMDTAKKLSEQRDSNPQVRQLKRRFLGQAAEIEMDGSGRLLVPPELRAAINL
FT                   EKRAMLIGQLHRFEIWKEESWADVDGTLDPAALPESVQELSF"
     gtgtttactg ggagcgcagc actcaatctg gatgccaaag ggcggctaac catgccgact        60
     cggtaccgtg cgtcgttaat cgacacgtgc ggtggccagc ttgtgcttac gctgcacccc       120
     tttgatgact gcctggcgct ctacccgcgt gctgaattta tggacaccgc aaaaaaactg       180
     tctgaacagc gcgactccaa cccgcaggtt cgccagctca aacggcgttt cttgggccaa       240
     gccgctgaaa ttgagatgga cggcagtggt cgtttgttgg tgccgccgga attgcgggcg       300
     gcaattaact tggagaaacg cgccatgctg atcggccagc tgcaccgttt tgaaatctgg       360
     aaagaagaga gttgggccga tgtggatggc accctggacc cggcagcgtt gccggaaagc       420
     gtgcaggagc tgtcgttctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page