(data stored in ACNUC7421 zone)

EMBL: AM286690.PE60

AM286690.PE60        Location/Qualifiers
FT   CDS_pept        61921..63291
FT                   /transl_table=11
FT                   /locus_tag="ABO_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15508"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTF4"
FT                   /protein_id="CAL15508.1"
FT                   /translation="MLIMRNALTVLLLSLSLTGLADTDCETGYFALQQALARAGIGDAQ
FT                   ARTLTGFPHLGVNRWLAFQQRKAVSEPQQQQWIRLATAKAWRDQSVLVQRLTTDSDGFS
FT                   PQTAQTLLASCLPVLAARTDFSVLPQAEIPDSYATWLRVAGMYPLMAWLATGSIDDYHR
FT                   EMSARFRDPARQPRQQFSPPTGGTVPVAPDVLSANPLRIPLPDTEQWQAMLSHYAPVVA
FT                   VSDTQPWNVPGQIQLDETHTPVIRTETPVSYTWPSWTHFRGKNLLQINYQFWFSKRPKR
FT                   GWLDTYAGSLDGVIWRVTLKPNGKVLFYDSIHPCGCYHKIYLVDPTLKAADIEGDKPVF
FT                   YPGYVVDAYDQRITLLLEPDTHYLVRVTPTSDLLPTSSYQLADANALRALKHQDGTVAS
FT                   LFNARGLVPISKRAERFYLWPMGIPSAGAMRQPGEHAIAFKGRRHFDEATLAETLFE"
     atgctaataa tgcgcaacgc actgacggta ctgttgctga gcctgtcgct caccgggttg        60
     gctgatactg attgcgaaac cgggtatttt gctttgcagc aggccttggc ccgagccggc       120
     attggtgatg cgcaggcacg aacgctgaca ggttttcctc acttgggcgt gaatcgttgg       180
     ttagcctttc agcagcgcaa ggccgtcagt gagcctcaac aacagcagtg gattcgtttg       240
     gctacagcca aggcctggcg agatcagtcc gttctggttc agcggctaac cacggatagt       300
     gatggatttt ccccgcaaac agcgcaaaca ttgctggcct cctgcctacc ggtgctcgcc       360
     gcccgaacag atttttctgt gttaccccaa gccgaaattc cggacagtta tgctacgtgg       420
     ttgcgggtag ccgggatgta ccctcttatg gcctggctgg ccacaggatc gattgatgat       480
     taccaccgag aaatgagtgc gcgttttcgt gatccggcgc gtcaaccgcg gcaacagttt       540
     tcgccgccta cgggcggcac tgtgccggtg gcgccggacg tattgtcggc gaatccgctg       600
     cgcatacctt tgccggatac agagcaatgg caggcaatgt tatcgcacta cgcgccggtt       660
     gttgcggtgt ccgacaccca gccttggaat gtgccggggc agattcagct agatgaaacg       720
     catacgccgg taatccgcac tgagacacct gtcagttata cttggccaag ctggacccat       780
     tttcgtggca aaaaccttct acaaatcaac taccaatttt ggttcagcaa gcgcccgaaa       840
     cgtggttggc tggatactta tgcgggctct cttgatgggg tgatttggcg ggtgaccctc       900
     aagcccaatg gcaaggtgct gttttacgac agcattcacc catgtggctg ttatcacaaa       960
     atttatcttg tcgacccgac gttgaaagcg gcagacatag agggtgataa gccggtgttc      1020
     tatcccggct acgtggtgga tgcttatgat caacgcatca ctctgttgct ggagccagac      1080
     acccattatc tggttcgcgt gaccccgaca tcagatctct tacctaccag ctcctatcag      1140
     ctggctgatg ccaacgcgct ccgagcgttg aaacatcaag atggtactgt cgccagcctg      1200
     ttcaatgccc gtgggcttgt gccaatctca aaacgggcag agcggttcta tttatggccc      1260
     atgggaatac cgtctgccgg cgccatgcgc cagccaggcg agcatgcgat cgcgttcaaa      1320
     ggtcgtcgtc attttgatga agcaaccttg gcagaaacat tgtttgaata g               1371
//

If you have problems or comments...

PBIL Back to PBIL home page