(data stored in ACNUC7421 zone)

EMBL: AM286690.PE67

AM286690.PE67        Location/Qualifiers
FT   CDS_pept        complement(69442..70839)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0067"
FT                   /product="oxidoreductase with NAD+ or NADP+ as acceptor"
FT                   /function="works in conjunction with acyl-CoA dehydrogenase
FT                   to catalyze the oxidation of CoA and reduce ubiquinone"
FT                   /EC_number="1.1.1.-"
FT                   /note="oxidoreductase FAD-binding putative identified by
FT                   match to TIGR protein family HMMTIGR01679 InterPro: FAD
FT                   linked oxidase C-terminal"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15515"
FT                   /db_xref="GOA:Q0VTE7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTE7"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01679"
FT                   /protein_id="CAL15515.1"
FT                   /translation="MMTALAHAALEQLTDLLGNRCLTDQESAERYGVDWTKVWAPAPCA
FT                   VALPETTEEVQQIVEIANEHGLHLVPSGGRTGLSAGAVAANNELVVAFDRMNTILDFNE
FT                   FDRAVTVQPGVITQQLQEFAEQKGLFYPVDFASAGSSQIGGNIGTNAGGIKVIRYGMTR
FT                   DWITGLKVVTGKGELLDLNKGLIKNATGYDFRHLFIGSEGTLGFVVEATVKLAREPKDL
FT                   TALVLGAPGFREVMKILHAFQQDIDLTAFEFFSDKAMAHVLEHGVAKPFDTECPFYCLL
FT                   EFEQLSEQIGDQAMAIFERCVEEGWVLDGVMSQSLQQLDQLWQLRERISESIAPHTPYK
FT                   NDISVTVSKVPDFVEDIDTVVQDAYPDFEIVWFGHIGDGNMHLNILKPADLPKEDFFAK
FT                   CNNVSKWVFEIVQKYNGSISAEHGVGMTKKPYLEYSRSPEEIACMKAVKQVFDPNNVMN
FT                   PGKLFDV"
     ttgatgactg cccttgccca tgctgcctta gagcaactaa ctgatttgct tggcaatcgc        60
     tgcctcaccg accaggaaag cgccgaacgt tacggggtcg actggaccaa ggtatgggca       120
     ccggcaccct gtgccgtggc actgccggaa accaccgagg aagtgcaaca gatcgtcgaa       180
     atcgccaacg agcatggttt gcacctcgtg ccatccgggg gtcgcaccgg cctgtccgct       240
     ggcgcagtcg ccgccaacaa tgagctagtc gtggcctttg atcgtatgaa tacgatcctc       300
     gatttcaacg aattcgaccg cgccgtcacc gtacagcccg gcgtcattac ccagcagctg       360
     caggaattcg ccgaacagaa aggtctgttc tatccggtcg attttgcctc cgccggctcc       420
     agccaaatcg gcggcaacat cggcaccaac gccggtggca tcaaggtaat tcgctacggc       480
     atgacccgcg attggatcac cggcctgaaa gtggtcaccg gcaagggtga actactggac       540
     ctgaacaagg gcctgatcaa gaacgccacc ggctatgact tccgccacct gtttatcggc       600
     tctgaaggca ccctgggctt tgtggtagaa gccacagtaa aactggcccg cgagcccaaa       660
     gacctgaccg ccctggtact gggcgcgcca ggcttccggg aagtaatgaa aatcctccat       720
     gccttccagc aggacatcga cctcaccgcc ttcgagttct tctccgacaa ggccatggcc       780
     cacgtgctgg aacacggtgt cgccaagcct ttcgataccg aatgcccgtt ctactgccta       840
     ctggaattcg agcaattgtc tgaacaaatt ggcgaccagg ccatggccat ttttgaacgc       900
     tgcgtggaag aaggctgggt actggacggc gtcatgagcc agtcgctaca gcagctggat       960
     cagctgtggc agctgcgcga acgcatctcc gaatccatcg cccctcacac cccctacaag      1020
     aacgacatct ccgtcaccgt ctctaaagtg ccggactttg tcgaagacat cgacaccgtg      1080
     gtgcaagacg cctacccgga tttcgaaatc gtctggttcg ggcacattgg cgacggcaac      1140
     atgcacctga acatcctcaa accagcagac ctgcccaagg aagacttctt cgccaagtgc      1200
     aataacgtct ccaagtgggt gttcgagatc gtgcagaaat acaacggctc gatttccgcc      1260
     gaacatggtg tgggcatgac caagaaaccc tacctcgaat actcccgcag cccggaagaa      1320
     atcgcctgca tgaaagcggt gaaacaggta ttcgacccca acaatgtgat gaacccggga      1380
     aaactgttcg atgtttga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page