(data stored in ACNUC7421 zone)

EMBL: AM286690.PE73

AM286690.PE73        Location/Qualifiers
FT   CDS_pept        complement(76396..77655)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0073"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="Region start changed from 77784 to 77655 (-129
FT                   bases) regional start was changed to be in accordance with
FT                   the results of the observations."
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15521"
FT                   /db_xref="GOA:Q0VKU0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VKU0"
FT                   /protein_id="CAL15521.1"
FT                   /translation="MRALLVLLHRWFGLFIAAFLIIAGLTGAVISWDHELDEWLNPHLF
FT                   TSQSQGEPLPMLELVRHVENADPRVRASFFALEAEPGHNAEIWVDAKVNPDTGRRYELG
FT                   YDHAFVDPVTGEIVGKREWGEISLHPEHLMSFLYKLHFTLHLPEWNGINRWGIWLMGAA
FT                   AMVWLFDTFIAMALTLPRKRRTQKPAGKSWLQRWKPAWMIRRGAGAYKLNFDLHRAVGL
FT                   WTFALLLMLAFTSFSLNLYREIFYPVMSIVSETTPGPFETRTPTALHDPVEPQVSWPAL
FT                   FQKARTHADNRGWDEPMGDTFYSDNFAVFGVRFYYPGEDHDSGGMKVKSLYYDGRSAAL
FT                   IGEEEPWEGTVADVFSQLQFPLHSGRIVGLPGRIIVSIMGIAVAMLSITGLVIWWKKRK
FT                   ARVTSKRRKQEAAMAATTTP"
     atgcgcgcat tactggttct acttcaccgc tggttcggtc tcttcattgc cgcttttctg        60
     attattgccg gcttgaccgg agccgtgatt tcttgggatc acgaattgga tgaatggctt       120
     aacccgcatc tttttacaag ccagagccaa ggcgagccac tgcccatgct ggaactggtc       180
     cgtcatgtgg aaaacgcgga cccgcgagtc cgggccagct tctttgccct agaagcagag       240
     ccgggccata acgccgaaat ctgggtggat gccaaagtaa acccggacac cgggcggcgc       300
     tacgaactgg gttacgacca tgccttcgta gatccggtta ccggcgaaat cgtcggcaaa       360
     cgcgaatggg gggaaatctc cctgcacccg gaacacctga tgtcgtttct gtacaagctg       420
     catttcaccc tgcacctgcc ggaatggaac ggcatcaacc gctggggcat ctggttgatg       480
     ggtgccgccg ccatggtctg gttattcgac acgtttatcg ccatggcgct gactctgccg       540
     cgcaaacgcc gcacccagaa accggcgggc aagagctggc tgcaacgctg gaaacccgcc       600
     tggatgattc gccgcggcgc gggcgcctac aaactgaatt tcgacctgca ccgggccgtc       660
     ggcctgtgga ccttcgcttt attgttgatg ctagccttta cctcattttc cctaaactta       720
     taccgagaaa tcttttaccc ggtcatgtct atagtgtccg aaactacccc cgggccgttt       780
     gaaacacgca cgcccaccgc attgcatgac cccgtagaac cccaggttag ctggcctgca       840
     ttgttccaaa aggctcgaac gcacgcggac aatcgcggct gggacgagcc catgggtgac       900
     accttctaca gcgacaattt tgcggtcttc ggggtgcgct tctactaccc aggggaagac       960
     cacgatagcg gcggaatgaa ggtgaagagc ctctattacg atggccgcag tgccgcttta      1020
     attggtgagg aagagccctg ggaaggcacc gtcgcggatg tcttcagcca actacagttc      1080
     cccctgcatt ctggtcgcat cgtcggtcta cctgggcgca ttatcgtctc aatcatgggc      1140
     attgcggtcg ccatgctctc catcaccggg ctggtaatct ggtggaagaa aagaaaggcg      1200
     agggtaacga gcaagcgtcg taaacaagaa gcagcgatgg cggctaccac cacgccttga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page