(data stored in ACNUC7421 zone)

EMBL: AM286690.PE78

AM286690.PE78        Location/Qualifiers
FT   CDS_pept        complement(82763..83209)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0078"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15526"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VKT5"
FT                   /protein_id="CAL15526.1"
FT                   /translation="MPDVIGATTMQRIEIHKTFPFSVDKLFNFLSVHENLELIFAPAKI
FT                   KRIKDGQDSPNGVGSTRKMQILIAPPFEETVTKIVPNERIEYAITKGSPLKHHKGVMRF
FT                   SEAANGGSKLDYTIEFEGKLPLIGPIIKAGLGQAIGRGLNKLKL"
     ttgccggacg taataggagc aaccaccatg caacgtatcg aaattcacaa gacctttccg        60
     ttttccgtgg acaagctgtt caactttctc agcgtgcacg aaaatctgga actgattttt       120
     gccccggcca agatcaaacg tattaaagac ggacaggaca gccccaacgg ggtaggttct       180
     acccgcaaaa tgcagatcct gatcgcgcca ccgttcgaag aaaccgtcac caagatagtg       240
     cctaacgagc gcattgaata cgccatcacc aagggcagcc ctctcaagca ccataagggc       300
     gtcatgcgct tttccgaagc cgccaatggc ggcagcaagc tggactacac catcgagttt       360
     gaaggcaagt tgccactgat cggcccgatc atcaaagccg gcctgggcca ggctatcggc       420
     cgagggctga acaagctaaa gctgtaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page