(data stored in ACNUC7421 zone)

EMBL: AM286690.PE79

AM286690.PE79        Location/Qualifiers
FT   CDS_pept        complement(83762..84301)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0079"
FT                   /product="acyltransferases"
FT                   /function="acetyl-coa + ribosomal-protein l-serine = coa +
FT                   ribosomal-protein n-acetyl-l-serine"
FT                   /EC_number="2.3.1.-"
FT                   /note="acyltransferase transferring groups other than
FT                   amino-acyl groups"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15527"
FT                   /db_xref="GOA:Q0VKT4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VKT4"
FT                   /protein_id="CAL15527.1"
FT                   /translation="MEVRVDANVTLHPLNQGFANDLFTLTNSNRNFLREWLPWLDQVLT
FT                   VDDTRHFIETAEKMAATGDAHSFAIVHLGTVCGVTGFNNINQPHHTGSIGYWLAQTHTG
FT                   QGIATSAVRQLLNIGFTEYTLNRIEIRCALNNRRSRALPERLGFVYEGTLRQAEWLYDR
FT                   FVDQALYALLKSDYRP"
     atggaggttc gcgtggacgc taatgtcacc ctacaccccc tgaatcaggg ctttgctaac        60
     gatctgttta cactcaccaa cagtaatcga aacttcctgc gcgaatggtt gccttggctg       120
     gatcaggtgt taacggtcga cgacacaaga cacttcattg aaaccgctga aaaaatggcc       180
     gccactggtg acgcccactc ctttgccatt gttcatttgg ggactgtatg tggcgtcacc       240
     gggttcaata atatcaacca acctcatcac acaggatcca tcgggtactg gctcgcgcag       300
     acccacacgg gtcagggcat cgcgacaagt gcggtcaggc aactcctcaa tattggtttc       360
     acagaatata cactcaaccg gatcgagatc cgctgtgcgc tgaacaacag gcgaagtcga       420
     gccctgccgg aacgattggg ttttgtgtac gaaggaacgc tcaggcaagc cgaatggctt       480
     tacgaccggt tcgtagatca ggcgctctac gcgttactca aatccgacta tcgaccataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page