(data stored in ACNUC7421 zone)

EMBL: AM286690.PE82

AM286690.PE82        Location/Qualifiers
FT   CDS_pept        87194..87451
FT                   /transl_table=11
FT                   /locus_tag="ABO_0082"
FT                   /product="putative truncated transposase"
FT                   /function="Transposase and inactivated derivatives"
FT                   /note="putative truncated transposase OrfA identified by
FT                   match to PFAM protein family HMMPF04218"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15530"
FT                   /db_xref="GOA:Q0VTL3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL3"
FT                   /inference="protein motif:HMMPFAM:HMMPF04218"
FT                   /protein_id="CAL15530.1"
FT                   /translation="MTRKRRSFTPEFKQEAAILVLDQGYTISQVSVSLGVVESALRRRV
FT                   KQLEAERHGVTPKGKALPLNSGVFRSWRPAAIGWNGRRAY"
     atgaccagaa aaagacgttc ctttactcct gaattcaagc aggaggccgc gattctagtg        60
     ctggatcaag gctatacaat ttctcaggtt agcgtatcgc ttggtgttgt cgagagtgcg       120
     ctgcggcgca gggtgaagca gcttgaagct gagcgccatg gggtcacgcc caaaggcaaa       180
     gccctacccc tgaacagcgg cgtattcagg agctggaggc ccgctgcgat cggttggaac       240
     gggagaagag catactaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page