(data stored in ACNUC7421 zone)

EMBL: AM286690.PE85

AM286690.PE85        Location/Qualifiers
FT   CDS_pept        complement(89667..91277)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0085"
FT                   /product="GMC oxidoreductase family protein, putative"
FT                   /note="identified by sequence similarity; identified by
FT                   match to PFAM protein family HMMPF00732; putative InterPro:
FT                   Glucose-methanol-choline (GMC) oxidoreductase"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15533"
FT                   /db_xref="GOA:Q0VTL0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTL0"
FT                   /inference="protein motif:HMMPFAM:HMMPF00732"
FT                   /protein_id="CAL15533.1"
FT                   /translation="MQDLTTLTINVKDPWKNPANGWDVIDGRTITDNRTLEADVIIVGT
FT                   GAGGGVSAEILSQRGLKVILVEAGKLKSSDDFKLDEGKAYRDLYQEGALRATKDAGMTV
FT                   MQGRTVGGTTVVNWTSSFRTPQKTLQYWHDEFGVQGLSQAQMAPWFQQMEDRLNIEKWA
FT                   MPPNANNDILKRGCDDKGWHSAIIPRNVSGCWNIGYCGMGCPTNAKQSMLVTTIPSALD
FT                   HGSTLIYSAQADTLIIEGDSVTGVRVRPLNDDKKPTGATVTLKAKTVIAAGGGIQSPAL
FT                   LMRSDAPDPNGLVGKRTFLHPTTFVFGLYDKEIAPYYGAPQSMYSDEFTFKHGVDGPAG
FT                   YKMEMMPMHPGLSGALIGGFGEQAREEIERLPNLATAIALIRDGFHEDNQGGTVELRDN
FT                   GEPLLDYPVNDYLLEGAKRSHLTMLEMQFAAGAKEVRPSHAHAGYYKSWKAAREGVAQL
FT                   DYAPVVTALGSAHVMGGLTMGADESRCTVNSDGSYKHLNGLYIIDGSVFPTSIGANPQL
FT                   SIYGLSARNASALADKLKG"
     atgcaggacc tcactaccct taccatcaac gtgaaagacc cgtggaaaaa cccagccaac        60
     ggctgggatg ttatcgacgg gcgcaccatc accgacaacc gcactttaga agccgatgtc       120
     atcatcgtag gtactggtgc tggcggcggc gttagtgcag aaatactcag ccagcgcggc       180
     ctcaaagtca tactggtgga agcaggcaaa ctaaaaagct ccgacgactt caaactggat       240
     gaaggtaagg cctaccgtga cctctaccaa gagggcgcgc tacgcgctac caaggatgcc       300
     ggcatgaccg taatgcaggg gcgcacggtg ggcggcacca ccgtggttaa ctggacgagt       360
     agcttccgca ccccccagaa aaccctgcaa tactggcacg atgaattcgg cgtacagggg       420
     cttagccagg cacaaatggc tccctggttt caacagatgg aagatcgtct aaacatagaa       480
     aagtgggcca tgccgcccaa cgccaacaac gacatactga aacggggctg cgatgacaaa       540
     ggctggcatt ccgccattat cccccgcaac gtaagcggct gctggaacat cggttattgc       600
     ggcatgggct gccccaccaa cgccaagcaa tccatgctgg tcactaccat tcccagcgct       660
     ctagatcacg gctccacact gatttacagc gctcaggccg acaccctgat cattgagggt       720
     gacagcgtta ccggcgtgcg agtgcggcca ctaaacgatg acaaaaagcc taccggcgcc       780
     acagtaacac taaaagccaa aaccgtaatt gccgcggggg ggggcattca aagtccggca       840
     ctgctgatgc gctccgacgc cccagacccg aacgggctag tgggtaagcg taccttcctg       900
     catcccacca cgtttgtgtt cggtctctac gataaagaaa tcgctccgta ttacggcgcc       960
     ccacaatcca tgtattccga cgagttcacg tttaaacacg gagtcgatgg cccggcgggt      1020
     tacaaaatgg aaatgatgcc catgcatccg ggcctgtctg gtgcattaat aggcggattc      1080
     ggcgaacaag cccgggaaga aatcgaacgt cttcccaact tggccaccgc tattgcccta      1140
     attcgcgatg gcttccatga agataaccaa ggtggcaccg tggagttgcg tgataacggc      1200
     gaacctctgc tcgattatcc cgtcaatgac tacctgctgg aaggtgccaa acgatcccac      1260
     ctgaccatgc tggaaatgca atttgccgct ggcgccaaag aagtacggcc cagccacgct      1320
     catgctggtt actacaaaag ctggaaagca gcccgcgaag gcgtggcaca actggactat      1380
     gcccctgtcg ttaccgcgct gggcagcgcc cacgttatgg gcgggctaac catgggagct      1440
     gatgagagcc gctgcaccgt caacagcgac ggcagctaca agcacctgaa cggcctctat      1500
     atcatagacg gctccgtatt ccccaccagc attggcgcca atccacaact ctccatctac      1560
     ggcctcagcg cccgcaatgc ctcagcattg gccgataaac tgaaaggctg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page