(data stored in ACNUC7421 zone)

EMBL: AM286690.PE89

AM286690.PE89        Location/Qualifiers
FT   CDS_pept        complement(94310..95479)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0089"
FT                   /product="hydrolase, alpha/beta fold family, putative"
FT                   /function="Predicted hydrolase of the alpha"
FT                   /note="(hydrolase alpha/beta fold family) identified by
FT                   match to TIGR protein family HMMTIGR01250 InterPro:
FT                   Esterase/lipase/thioesterase family active site enzymes of
FT                   the alpha/beta fold enzymes operate on substrates with
FT                   different chemical composition in various biological
FT                   contexts"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15538"
FT                   /db_xref="GOA:Q0VTK5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTK5"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01250"
FT                   /protein_id="CAL15538.1"
FT                   /translation="MVACASTQLYKLTYMKVLIIKKAARHGISITNRCQREKQKATIPA
FT                   PRPRRDFANPMDETLPMGEIVQSAFRPPLWLRNPHLQTLWGPMGRTLPEVTRRTERLNL
FT                   KDGDYLLLDWAGPQSQPGQLTVMLLHGLSGCSDSHYMRGIQKVLAEAGIRSVAINSRGA
FT                   KKPNDTALCYHAGEVDDVDAVIDHVFHENPTGHRIAIGVSLGGSRLLNWLAHRDNNHLS
FT                   AVATICAPLRLDICANRLDQGLSKLYRQHLLKNLLTNFERQKIHLDKVNPPEAKRLHRL
FT                   NMNSIRSFWRYDDQIIAPLYGFRSAWHYYAQCSAGPKLLQIRTPTLMLQNRDDPFMTPQ
FT                   TLPRQEELGPAVTLEVSDYGGHVGFVGYKSQRYWLEQRLLAFVQGFGIR"
     atggtggctt gcgctagcac ccaactctac aagctgacct acatgaaagt tctgatcatc        60
     aaaaaagcgg cgcggcatgg aatctccatc acgaataggt gccagcggga aaaacaaaag       120
     gctaccatac ctgcgccacg cccccggcgt gattttgcca acccgatgga tgagacattg       180
     cctatgggcg agattgtaca gtcggcattc cggccaccac tatggttacg caacccccac       240
     ctgcaaaccc tgtgggggcc catgggccgc accctgccgg aagtcacgcg gcgcacggaa       300
     cggctgaacc tgaaagacgg tgattatctg ttgctagact gggccggacc acagagccaa       360
     cccgggcagc tgacggtgat gttattacat gggctatccg ggtgcagcga ctcccattac       420
     atgcgcggca tacaaaaagt gttggctgaa gcgggaatcc gttctgtggc catcaacagt       480
     cgcggggcca aaaaacccaa cgacaccgcg ttgtgttatc acgcgggcga agtggatgat       540
     gtggatgcag tgatcgacca tgtgttccac gaaaacccca ctggccaccg cattgccatc       600
     ggcgtctctc taggcggcag ccggctactg aactggctgg cccaccggga caacaaccac       660
     ctcagtgccg tagccaccat ttgtgctccc ttgcggctgg atatctgtgc caaccggctg       720
     gatcaaggct tgtcgaaatt gtaccgccaa cacctgttaa aaaacctttt gaccaacttc       780
     gaaaggcaga aaatccatct ggacaaggtc aaccccccgg aggccaaacg actacatcgc       840
     ctgaacatga atagcatccg ttcgttttgg cgctacgacg accaaatcat cgccccgtta       900
     tatggctttc ggagtgcctg gcattattac gcgcaatgct ccgcgggtcc caagttgcta       960
     caaatccgca cccccacgtt gatgctgcaa aaccgtgacg acccgtttat gactccacaa      1020
     acgttacccc ggcaggaaga gctcgggcca gcggtgacac tggaggtaag cgattacggt      1080
     gggcatgtgg gctttgtcgg ctacaaaagc cagcgttact ggttagaaca acggctatta      1140
     gcgtttgtgc aaggtttcgg gattcgctga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page