(data stored in ACNUC7421 zone)

EMBL: AM286690.PE90

AM286690.PE90        Location/Qualifiers
FT   CDS_pept        95402..96124
FT                   /transl_table=11
FT                   /locus_tag="ABO_0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15537"
FT                   /db_xref="GOA:Q0VTK6"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTK6"
FT                   /protein_id="CAL15537.1"
FT                   /translation="MPRRFFDDQNFHVGQLVELGASASHHIGKVLRMAVADELVVFNGR
FT                   GGEWLARISAINKKAVCIEPLTFTDEDRCAPLAVTVALPMIKGERMDYAIQKATELGAT
FT                   ALVILDTERCEVRLKGERQEKKLGHWQQVAISACEQCGLNRVPVVHGVLSLRDWLTSDL
FT                   PALKLIAHPGEKSFSAAALQGQTELALLTGPEGGFSNDELQQAADAGFSPFALGNRVLR
FT                   AETAPVALLAALWAWHGH"
     atgccgcgcc gcttttttga tgatcagaac tttcatgtag gtcagcttgt agagttgggt        60
     gctagcgcaa gccaccatat tggcaaggtg ttacgcatgg cggtggctga tgaattagtg       120
     gtgtttaacg gccgcggcgg tgaatggtta gcgcgtatct ctgccatcaa caaaaaggcg       180
     gtctgcattg agccgcttac gttcacggat gaagatcgtt gcgctccttt ggcggtgacg       240
     gtggcgttgc cgatgatcaa aggcgagcgc atggactatg cgatccagaa ggccactgag       300
     ctgggcgcca ctgccctggt gatcctggac acggaacgtt gtgaagtccg cctaaagggt       360
     gagcgtcagg aaaagaagct gggccattgg cagcaagtcg ctatcagtgc ctgtgagcaa       420
     tgtggcctga accgggtgcc ggtggtgcac ggcgtgctga gcctgcgtga ctggctgaca       480
     tctgatcttc ccgccctgaa gttgatagcc catccgggcg aaaagtcctt ctctgcggct       540
     gccttgcagg ggcaaacgga gctggcgttg ctgacggggc cggaaggtgg cttttccaat       600
     gatgaattac agcaggcggc ggatgcgggc tttagcccgt tcgcgttagg caaccgggtg       660
     ttgcgagcgg aaaccgcccc ggtggcgttg ctggcggccc tgtgggcctg gcatggccac       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page