(data stored in ACNUC7421 zone)

EMBL: AM286690.PE91

AM286690.PE91        Location/Qualifiers
FT   CDS_pept        96114..96530
FT                   /transl_table=11
FT                   /locus_tag="ABO_0091"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15539"
FT                   /db_xref="GOA:Q0VTK4"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTK4"
FT                   /protein_id="CAL15539.1"
FT                   /translation="MATKGKARPRRSRRRTGSKAVAASGIIAALMALAVFALVLGIYAR
FT                   HNRLLPYLAGVYAVPSVLVFGLYGWDKRVAVRGGSRTSEQSLHLLALAGGWPGAMLARS
FT                   LFRHKTRKQPFTGIFWCTVLFNVGTVSVLLGEVG"
     atggccacta aggggaaggc ccggccccgg agatcgcgcc gtcgcacagg ttccaaggca        60
     gttgctgcat cgggcatcat cgcggcactg atggcccttg cagtgtttgc gctagtgttg       120
     ggcatttatg cccgccacaa caggctgctg ccctacttgg caggcgttta tgcggtgccg       180
     tcggtgcttg tattcgggct ttatgggtgg gataagcgcg tcgccgtgcg agggggttct       240
     cgtacttctg agcaaagctt gcacctattg gcgctggccg gggggtggcc cggtgcgatg       300
     ttggctcgtt ctctgtttcg tcacaaaacc cgtaagcaac cgttcactgg aattttctgg       360
     tgcacggtgc tgtttaatgt gggcacggta agtgtgttgc tgggcgaggt gggctag          417
//

If you have problems or comments...

PBIL Back to PBIL home page