(data stored in ACNUC7421 zone)

EMBL: AM286690.PE98

AM286690.PE98        Location/Qualifiers
FT   CDS_pept        complement(101418..101966)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0098"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="(slyD) (peptidyl-prolyl cis-trans isomerase
FT                   FKBP-type) identified by sequence similarity; putative
FT                   InterPro: FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (PPIase)"
FT                   /note="Specificity unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15546"
FT                   /db_xref="GOA:Q0VTJ7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTJ7"
FT                   /protein_id="CAL15546.1"
FT                   /translation="MPVHWAVQRLLTFFPPREACMTIQNDKVATLHYRLFNADDGSEIE
FT                   NSRDNGEPMAYLHGYNNIIKGLESALEGRATGDNVDVTISPEDGYGEYDNTLFQRISRK
FT                   YLKHAGKLEPGKVVTVSTDEGPRMLTILKVGLKTVDVDANHPLAGKALRFVVDITDIRD
FT                   ATDEEIAHKHAHGAGGHQH"
     atgcctgtgc actgggccgt ccaacggctc ctcacatttt ttcccccaag agaagcttgc        60
     atgactatcc aaaatgacaa ggtcgccacc ttgcactacc gcctcttcaa cgccgacgat       120
     ggtagcgaaa ttgaaaattc ccgagacaac ggcgagccta tggcctacct gcatggttac       180
     aacaatatca tcaagggctt ggaatcagcg ctggaaggaa gagcgaccgg cgacaacgtg       240
     gatgtgacca tcagccctga agacggctat ggtgagtacg acaacacgct gttccaacgc       300
     atctcccgca agtacctgaa acacgctggt aagcttgagc caggcaaagt cgtcaccgtc       360
     tccaccgacg aaggcccacg tatgctcacc atcctgaagg tgggcctaaa aactgtcgac       420
     gtggacgcca atcacccctt ggcgggtaag gctctgcgtt tcgttgtcga catcacagat       480
     attcgtgatg ccaccgacga ggaaatagcc cataagcatg cccatggcgc tggtgggcac       540
     cagcactaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page